Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   PPM66_RS11190 Genome accession   NZ_CP116867
Coordinates   2146630..2146803 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain MGP008     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2141630..2151803
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PPM66_RS11175 gcvT 2142429..2143517 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  PPM66_RS11180 hepAA 2143959..2145632 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  PPM66_RS11185 yqhG 2145653..2146447 (+) 795 WP_003230200.1 YqhG family protein -
  PPM66_RS11190 sinI 2146630..2146803 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  PPM66_RS11195 sinR 2146837..2147172 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PPM66_RS11200 tasA 2147265..2148050 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  PPM66_RS11205 sipW 2148114..2148686 (-) 573 WP_003246088.1 signal peptidase I SipW -
  PPM66_RS11210 tapA 2148670..2149431 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  PPM66_RS11215 yqzG 2149703..2150029 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  PPM66_RS11220 spoIITA 2150071..2150250 (-) 180 WP_003230176.1 YqzE family protein -
  PPM66_RS11225 comGG 2150321..2150695 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  PPM66_RS11230 comGF 2150696..2151079 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  PPM66_RS11235 comGE 2151105..2151452 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=780462 PPM66_RS11190 WP_003230187.1 2146630..2146803(+) (sinI) [Bacillus subtilis subsp. subtilis strain MGP008]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=780462 PPM66_RS11190 WP_003230187.1 2146630..2146803(+) (sinI) [Bacillus subtilis subsp. subtilis strain MGP008]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1