NTDB

Overview

Name	comGC/cglC	Type	Machinery gene
Locus tag	POF58_RS01135	Genome accession	NZ_CP116711
Coordinates	191204..191533 (+)	Length	109 a.a.
NCBI ID	WP_000793380.1	Uniprot ID	A0A0E1EKJ1
Organism	Streptococcus agalactiae strain CNCTC 10/84 Cas9 AEKOrevertant
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 186204..196533

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
POF58_RS01120 (POF58_01120)	-	188762..189127 (+)	366	WP_000285373.1	DUF1033 family protein	-
POF58_RS01125 (POF58_01125)	comYA	189299..190270 (+)	972	WP_000250801.1	competence type IV pilus ATPase ComGA	Machinery gene
POF58_RS01130 (POF58_01130)	comYB	190164..191207 (+)	1044	WP_228313184.1	competence type IV pilus assembly protein ComGB	Machinery gene
POF58_RS01135 (POF58_01135)	comGC/cglC	191204..191533 (+)	330	WP_000793380.1	competence type IV pilus major pilin ComGC	Machinery gene
POF58_RS01140 (POF58_01140)	comYD	191508..191921 (+)	414	WP_000244259.1	competence type IV pilus minor pilin ComGD	Machinery gene
POF58_RS01145 (POF58_01145)	comGE	191893..192192 (+)	300	WP_038406052.1	competence type IV pilus minor pilin ComGE	-
POF58_RS01150 (POF58_01150)	comGF	192146..192607 (+)	462	WP_001874060.1	competence type IV pilus minor pilin ComGF	-
POF58_RS01155 (POF58_01155)	comGG	192585..192956 (+)	372	WP_000601105.1	competence type IV pilus minor pilin ComGG	-
POF58_RS01160 (POF58_01160)	comYH	193071..194045 (+)	975	WP_001008567.1	class I SAM-dependent methyltransferase	Machinery gene
POF58_RS01165 (POF58_01165)	-	194077..195270 (+)	1194	WP_000047534.1	acetate kinase	-
POF58_RS01170 (POF58_01170)	-	195398..195590 (+)	193	Protein_174	helix-turn-helix transcriptional regulator	-
POF58_RS01175 (POF58_01175)	-	195569..195835 (+)	267	Protein_175	hypothetical protein	-

Sequence

Protein

Download Length: 109 a.a. Molecular weight: 12129.27 Da Isoelectric Point: 10.0311

                                >NTDB_id=779456 POF58_RS01135 WP_000793380.1 191204..191533(+) (comGC/cglC) [Streptococcus agalactiae strain CNCTC 10/84 Cas9 AEKOrevertant]

MKNLLLKCKDKKVKAFTLLEMLVVLIIISVLLLLFVPNLSKQKESVTRTGNAAVVKVVESQAELFELQETGRKASLSTLK

SGGYITEKQEKAYLDYYKDSSNGSQKISS

Nucleotide

Download Length: 330 bp

                                >NTDB_id=779456 POF58_RS01135 WP_000793380.1 191204..191533(+) (comGC/cglC) [Streptococcus agalactiae strain CNCTC 10/84 Cas9 AEKOrevertant]

ATGAAAAATTTATTGTTAAAATGTAAGGATAAGAAGGTTAAAGCATTTACACTTTTAGAAATGTTAGTTGTTTTGATCAT

TATTTCGGTCTTGTTGTTATTGTTTGTACCCAATTTATCAAAACAAAAGGAAAGTGTCACAAGAACTGGAAATGCTGCTG

TTGTCAAGGTTGTAGAAAGTCAAGCCGAACTTTTTGAACTGCAAGAAACAGGTAGAAAAGCTAGTTTATCCACTCTAAAA

TCTGGAGGATATATTACTGAAAAGCAAGAGAAAGCCTATTTAGATTATTATAAAGACAGTTCCAATGGTTCTCAGAAAAT

TTCAAGTTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(11-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A0E1EKJ1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC/cglC	Streptococcus mitis NCTC 12261	60.55	100	0.606
comGC/cglC	Streptococcus mitis SK321	59.633	100	0.596
comYC	Streptococcus gordonii str. Challis substr. CH1	61.165	94.495	0.578
comGC/cglC	Streptococcus pneumoniae TIGR4	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae R6	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae Rx1	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae D39	57.798	100	0.578
comYC	Streptococcus mutans UA159	55.238	96.33	0.532
comYC	Streptococcus mutans UA140	55.238	96.33	0.532
comGC	Lactococcus lactis subsp. cremoris KW2	63.043	84.404	0.532
comYC	Streptococcus suis isolate S10	65.854	75.229	0.495

Detailed information NTG0779456