Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   QYC34_RS18340 Genome accession   NZ_CP129338
Coordinates   3369677..3369817 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM126725     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3364677..3374817
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QYC34_RS18315 (QYC34_18315) yuxO 3365027..3365407 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  QYC34_RS18320 (QYC34_18320) comA 3365426..3366070 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QYC34_RS18325 (QYC34_18325) comP 3366151..3368448 (-) 2298 WP_087614687.1 histidine kinase Regulator
  QYC34_RS18330 (QYC34_18330) comX 3368456..3368617 (-) 162 WP_003241045.1 competence pheromone ComX -
  QYC34_RS18335 (QYC34_18335) comQ 3368632..3369492 (-) 861 WP_046160795.1 polyprenyl synthetase family protein Regulator
  QYC34_RS18340 (QYC34_18340) degQ 3369677..3369817 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QYC34_RS18345 (QYC34_18345) - 3370039..3370164 (+) 126 WP_120028613.1 hypothetical protein -
  QYC34_RS18350 (QYC34_18350) - 3370279..3370647 (+) 369 WP_046160796.1 hypothetical protein -
  QYC34_RS18355 (QYC34_18355) pdeH 3370623..3371852 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  QYC34_RS18360 (QYC34_18360) pncB 3371989..3373461 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  QYC34_RS18365 (QYC34_18365) pncA 3373477..3374028 (-) 552 WP_046160797.1 cysteine hydrolase family protein -
  QYC34_RS18370 (QYC34_18370) yueI 3374125..3374523 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=778348 QYC34_RS18340 WP_003220708.1 3369677..3369817(-) (degQ) [Bacillus subtilis strain SRCM126725]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=778348 QYC34_RS18340 WP_003220708.1 3369677..3369817(-) (degQ) [Bacillus subtilis strain SRCM126725]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1