Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LLNCDO702_RS11650 Genome accession   NZ_CP129159
Coordinates   2308410..2308694 (-) Length   94 a.a.
NCBI ID   WP_003129993.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain NCDO702     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2303410..2313694
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLNCDO702_RS11620 (LLNCDO702_11610) - 2303842..2304219 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  LLNCDO702_RS11625 (LLNCDO702_11615) - 2304423..2305289 (+) 867 WP_003129984.1 RluA family pseudouridine synthase -
  LLNCDO702_RS11630 (LLNCDO702_11620) - 2305328..2306137 (-) 810 WP_014570791.1 metal ABC transporter permease -
  LLNCDO702_RS11635 (LLNCDO702_11625) - 2306130..2306867 (-) 738 WP_003129989.1 metal ABC transporter ATP-binding protein -
  LLNCDO702_RS11640 (LLNCDO702_11630) - 2307044..2307886 (-) 843 WP_003129990.1 metal ABC transporter substrate-binding protein -
  LLNCDO702_RS11645 (LLNCDO702_11635) - 2307883..2308320 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  LLNCDO702_RS11650 (LLNCDO702_11640) comGG 2308410..2308694 (-) 285 WP_003129993.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLNCDO702_RS11655 (LLNCDO702_11645) comGF 2308733..2309179 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLNCDO702_RS11660 (LLNCDO702_11650) comGE 2309142..2309438 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLNCDO702_RS11665 (LLNCDO702_11655) comGD 2309410..2309841 (-) 432 WP_080585155.1 competence type IV pilus minor pilin ComGD Machinery gene
  LLNCDO702_RS11670 (LLNCDO702_11660) comGC 2309801..2310184 (-) 384 WP_081040865.1 competence type IV pilus major pilin ComGC Machinery gene
  LLNCDO702_RS11675 (LLNCDO702_11665) comGB 2310198..2311271 (-) 1074 WP_014570824.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLNCDO702_RS11680 (LLNCDO702_11670) comGA 2311165..2312104 (-) 940 Protein_2275 competence type IV pilus ATPase ComGA -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=777375 LLNCDO702_RS11650 WP_003129993.1 2308410..2308694(-) (comGG) [Lactococcus lactis subsp. lactis strain NCDO702]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=777375 LLNCDO702_RS11650 WP_003129993.1 2308410..2308694(-) (comGG) [Lactococcus lactis subsp. lactis strain NCDO702]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585