Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/blpR   Type   Regulator
Locus tag   QWH96_RS02570 Genome accession   NZ_CP128987
Coordinates   485289..485507 (+) Length   72 a.a.
NCBI ID   WP_072135532.1    Uniprot ID   -
Organism   Streptococcus dysgalactiae subsp. equisimilis strain NS3396     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 480289..490507
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QWH96_RS02540 (QWH96_02545) - 481298..481873 (+) 576 WP_049520061.1 uracil-DNA glycosylase family protein -
  QWH96_RS02545 (QWH96_02550) ybeY 482032..482529 (+) 498 WP_003049887.1 rRNA maturation RNase YbeY -
  QWH96_RS02550 (QWH96_02555) - 482510..482917 (+) 408 WP_003047078.1 diacylglycerol kinase -
  QWH96_RS02555 (QWH96_02560) era 483037..483933 (+) 897 WP_002985743.1 GTPase Era -
  QWH96_RS02560 (QWH96_02565) - 483953..484429 (+) 477 WP_014635332.1 NUDIX domain-containing protein -
  QWH96_RS02565 (QWH96_02570) - 484734..484988 (-) 255 WP_011106868.1 hypothetical protein -
  QWH96_RS02570 (QWH96_02575) comE/blpR 485289..485507 (+) 219 WP_072135532.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  QWH96_RS02575 (QWH96_02580) - 485728..487310 (-) 1583 Protein_462 ABC transporter transmembrane domain-containing protein -
  QWH96_RS02580 (QWH96_02585) - 487608..487832 (+) 225 WP_002994580.1 Blp family class II bacteriocin -
  QWH96_RS02585 (QWH96_02590) - 487810..487986 (+) 177 WP_002994581.1 hypothetical protein -
  QWH96_RS02590 (QWH96_02595) - 488677..488805 (+) 129 WP_002994583.1 hypothetical protein -
  QWH96_RS02595 (QWH96_02600) - 489203..489430 (+) 228 WP_028797129.1 Blp family class II bacteriocin -
  QWH96_RS02600 (QWH96_02605) - 489479..489796 (+) 318 WP_002994587.1 hypothetical protein -

Sequence

Protein


Download         Length: 72 a.a.        Molecular weight: 8666.13 Da        Isoelectric Point: 10.5045

>NTDB_id=776824 QWH96_RS02570 WP_072135532.1 485289..485507(+) (comE/blpR) [Streptococcus dysgalactiae subsp. equisimilis strain NS3396]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKVYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=776824 QWH96_RS02570 WP_072135532.1 485289..485507(+) (comE/blpR) [Streptococcus dysgalactiae subsp. equisimilis strain NS3396]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGGTTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains

Predicted by InterProScan.

LytTr DNA-binding domain (LytTR)

(3-55)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417