Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   PJW01_RS27630 Genome accession   NZ_CP116325
Coordinates   5273495..5273773 (+) Length   92 a.a.
NCBI ID   WP_000799098.1    Uniprot ID   A0A9W5VHK7
Organism   Bacillus thuringiensis strain BLB1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 5265830..5313155 5273495..5273773 within 0


Gene organization within MGE regions


Location: 5265830..5313155
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PJW01_RS27565 (PJW01_27565) - 5265830..5266954 (-) 1125 WP_000679465.1 tyrosine-type recombinase/integrase -
  PJW01_RS27570 (PJW01_27570) - 5267113..5267976 (-) 864 WP_000703672.1 hypothetical protein -
  PJW01_RS27575 (PJW01_27575) - 5268538..5269677 (+) 1140 WP_000838797.1 AimR family lysis-lysogeny pheromone receptor -
  PJW01_RS27580 (PJW01_27580) - 5269680..5269823 (+) 144 WP_000710221.1 hypothetical protein -
  PJW01_RS27585 (PJW01_27585) - 5270049..5270171 (+) 123 WP_000237930.1 hypothetical protein -
  PJW01_RS27590 (PJW01_27590) - 5270191..5270544 (-) 354 WP_000172107.1 helix-turn-helix domain-containing protein -
  PJW01_RS27595 (PJW01_27595) - 5270721..5271008 (+) 288 WP_240494432.1 helix-turn-helix domain-containing protein -
  PJW01_RS27600 (PJW01_27600) - 5271005..5271355 (+) 351 WP_001246222.1 helix-turn-helix domain-containing protein -
  PJW01_RS27605 (PJW01_27605) - 5271352..5271519 (+) 168 WP_000969632.1 hypothetical protein -
  PJW01_RS27610 (PJW01_27610) - 5271549..5271725 (+) 177 WP_001084331.1 hypothetical protein -
  PJW01_RS27615 (PJW01_27615) - 5271730..5272470 (+) 741 WP_000190244.1 DnaD domain protein -
  PJW01_RS27620 (PJW01_27620) - 5272418..5273281 (+) 864 WP_001148230.1 ATP-binding protein -
  PJW01_RS27625 (PJW01_27625) - 5273284..5273478 (+) 195 WP_000337984.1 hypothetical protein -
  PJW01_RS27630 (PJW01_27630) abrB 5273495..5273773 (+) 279 WP_000799098.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  PJW01_RS27635 (PJW01_27635) - 5273766..5274125 (+) 360 WP_001125972.1 hypothetical protein -
  PJW01_RS27640 (PJW01_27640) - 5274144..5274311 (+) 168 WP_000717829.1 DUF3954 domain-containing protein -
  PJW01_RS27645 (PJW01_27645) - 5274337..5274588 (+) 252 WP_000109543.1 hypothetical protein -
  PJW01_RS27650 (PJW01_27650) - 5274608..5275117 (+) 510 WP_001054607.1 dUTP diphosphatase -
  PJW01_RS27655 (PJW01_27655) - 5275158..5275631 (+) 474 WP_001134294.1 hypothetical protein -
  PJW01_RS27660 (PJW01_27660) - 5275628..5276065 (+) 438 WP_002134064.1 hypothetical protein -
  PJW01_RS27665 (PJW01_27665) - 5276101..5276298 (+) 198 WP_000323893.1 hypothetical protein -
  PJW01_RS27670 (PJW01_27670) - 5276291..5276824 (+) 534 WP_001030635.1 hypothetical protein -
  PJW01_RS27675 (PJW01_27675) - 5276854..5277237 (+) 384 WP_000455138.1 hypothetical protein -
  PJW01_RS27680 (PJW01_27680) - 5277281..5277553 (+) 273 WP_001268380.1 hypothetical protein -
  PJW01_RS27685 (PJW01_27685) - 5277593..5277802 (+) 210 WP_000670920.1 hypothetical protein -
  PJW01_RS27690 (PJW01_27690) - 5277833..5278000 (+) 168 WP_000539656.1 hypothetical protein -
  PJW01_RS27695 (PJW01_27695) - 5278144..5278572 (+) 429 WP_000350118.1 hypothetical protein -
  PJW01_RS27700 (PJW01_27700) - 5278617..5278778 (+) 162 WP_002134063.1 hypothetical protein -
  PJW01_RS27705 (PJW01_27705) - 5278813..5279178 (+) 366 WP_002134061.1 hypothetical protein -
  PJW01_RS27710 (PJW01_27710) - 5279212..5279388 (+) 177 WP_000406974.1 hypothetical protein -
  PJW01_RS27715 (PJW01_27715) - 5279424..5279621 (+) 198 WP_000351065.1 hypothetical protein -
  PJW01_RS27720 (PJW01_27720) - 5279618..5279896 (+) 279 WP_000873130.1 hypothetical protein -
  PJW01_RS27725 (PJW01_27725) - 5280016..5280402 (+) 387 WP_001226456.1 YopX family protein -
  PJW01_RS27730 (PJW01_27730) - 5280531..5280701 (+) 171 WP_000677456.1 hypothetical protein -
  PJW01_RS27735 (PJW01_27735) - 5280729..5281211 (+) 483 WP_000166188.1 ArpU family phage packaging/lysis transcriptional regulator -
  PJW01_RS27740 (PJW01_27740) - 5281211..5281753 (+) 543 WP_016090301.1 site-specific integrase -
  PJW01_RS27745 (PJW01_27745) - 5282399..5282641 (+) 243 WP_000370222.1 hypothetical protein -
  PJW01_RS27750 (PJW01_27750) - 5282634..5283068 (+) 435 WP_000002735.1 hypothetical protein -
  PJW01_RS27755 (PJW01_27755) - 5283068..5283292 (+) 225 WP_000964495.1 hypothetical protein -
  PJW01_RS27760 (PJW01_27760) - 5283297..5283461 (+) 165 WP_001091354.1 helix-turn-helix domain-containing protein -
  PJW01_RS27765 (PJW01_27765) - 5283569..5283709 (+) 141 WP_228522936.1 hypothetical protein -
  PJW01_RS27770 (PJW01_27770) - 5283741..5284103 (+) 363 WP_228161156.1 HNH endonuclease -
  PJW01_RS27775 (PJW01_27775) - 5284203..5284724 (+) 522 WP_000113652.1 phage terminase small subunit P27 family -
  PJW01_RS27780 (PJW01_27780) - 5284734..5286449 (+) 1716 WP_001082759.1 terminase large subunit -
  PJW01_RS27785 (PJW01_27785) - 5286463..5287683 (+) 1221 WP_000264107.1 phage portal protein -
  PJW01_RS27790 (PJW01_27790) - 5287778..5288971 (-) 1194 WP_000499523.1 IS110-like element ISBth13 family transposase -
  PJW01_RS27795 (PJW01_27795) - 5289262..5289960 (+) 699 WP_002134054.1 head maturation protease, ClpP-related -
  PJW01_RS27800 (PJW01_27800) - 5289998..5291170 (+) 1173 WP_001123701.1 phage major capsid protein -
  PJW01_RS27805 (PJW01_27805) - 5291205..5291498 (+) 294 WP_000904085.1 head-tail connector protein -
  PJW01_RS27810 (PJW01_27810) - 5291495..5291839 (+) 345 WP_001068032.1 phage head closure protein -
  PJW01_RS27815 (PJW01_27815) - 5291827..5292264 (+) 438 WP_000818832.1 HK97-gp10 family putative phage morphogenesis protein -
  PJW01_RS27820 (PJW01_27820) - 5292261..5292623 (+) 363 WP_001243517.1 DUF3168 domain-containing protein -
  PJW01_RS27825 (PJW01_27825) - 5292639..5293223 (+) 585 WP_001251821.1 major tail protein -
  PJW01_RS27830 (PJW01_27830) gpG 5293280..5293654 (+) 375 WP_015382157.1 phage tail assembly chaperone G -
  PJW01_RS27835 (PJW01_27835) - 5293819..5298816 (+) 4998 WP_044157404.1 phage tail tape measure protein -
  PJW01_RS27840 (PJW01_27840) - 5298856..5300325 (+) 1470 WP_015382160.1 distal tail protein Dit -
  PJW01_RS27845 (PJW01_27845) - 5300322..5304716 (+) 4395 WP_015382161.1 phage tail spike protein -
  PJW01_RS27850 (PJW01_27850) - 5304733..5305110 (+) 378 WP_000354142.1 hypothetical protein -
  PJW01_RS27855 (PJW01_27855) - 5305147..5305428 (+) 282 WP_000215408.1 hypothetical protein -
  PJW01_RS27860 (PJW01_27860) - 5305431..5305636 (+) 206 Protein_5439 hypothetical protein -
  PJW01_RS27865 (PJW01_27865) - 5305636..5306454 (+) 819 WP_000542507.1 GH25 family lysozyme -
  PJW01_RS27870 (PJW01_27870) - 5306499..5306807 (-) 309 WP_002133890.1 YolD-like family protein -
  PJW01_RS27875 (PJW01_27875) - 5307104..5307892 (+) 789 WP_000794364.1 sulfotransferase family 2 domain-containing protein -
  PJW01_RS27880 (PJW01_27880) - 5307981..5308754 (+) 774 WP_000027993.1 sulfite exporter TauE/SafE family protein -
  PJW01_RS27885 (PJW01_27885) - 5308795..5309586 (+) 792 WP_000349585.1 sulfotransferase family 2 domain-containing protein -
  PJW01_RS27890 (PJW01_27890) - 5309655..5310059 (-) 405 WP_000247457.1 DUF6262 family protein -
  PJW01_RS27895 (PJW01_27895) - 5310052..5312061 (-) 2010 WP_001028065.1 tyrosine-type recombinase/integrase -
  PJW01_RS27900 (PJW01_27900) - 5312058..5313155 (-) 1098 WP_000477499.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 9941.45 Da        Isoelectric Point: 5.1782

>NTDB_id=776643 PJW01_RS27630 WP_000799098.1 5273495..5273773(+) (abrB) [Bacillus thuringiensis strain BLB1]
MKNTGVSRKVDELGRVVIPVELRRNLGIVEGTALGFHVEGENIVLKKQDKSCFVTGEVSESNIELLEGRMFLSKEGASEL
LGAIEKSGIVNA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=776643 PJW01_RS27630 WP_000799098.1 5273495..5273773(+) (abrB) [Bacillus thuringiensis strain BLB1]
ATGAAAAACACAGGTGTTTCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAGTAGAGTTACGCAGAAATTTAGG
AATTGTTGAAGGTACAGCATTAGGATTTCATGTTGAAGGGGAAAACATCGTTTTAAAAAAACAGGATAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAATCAAACATAGAGTTGCTAGAGGGTCGGATGTTTTTAAGTAAGGAAGGTGCAAGTGAGTTG
CTGGGCGCTATTGAGAAGAGTGGGATTGTAAATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-48)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.322

94.565

0.533