Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | PGS39_RS10910 | Genome accession | NZ_CP116204 |
| Coordinates | 2102967..2103245 (+) | Length | 92 a.a. |
| NCBI ID | WP_000799086.1 | Uniprot ID | A0A7D8D6B3 |
| Organism | Bacillus paranthracis strain NVH_0075/95 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2094219..2138616 | 2102967..2103245 | within | 0 |
Gene organization within MGE regions
Location: 2094219..2138616
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGS39_RS10840 (PGS39_10840) | - | 2094219..2094746 (+) | 528 | WP_000460208.1 | hypothetical protein | - |
| PGS39_RS10845 (PGS39_10845) | - | 2094766..2095935 (+) | 1170 | WP_000588613.1 | DEAD/DEAH box helicase | - |
| PGS39_RS10850 (PGS39_10850) | - | 2096059..2096235 (+) | 177 | Protein_2050 | VOC family protein | - |
| PGS39_RS10855 (PGS39_10855) | - | 2096318..2097427 (-) | 1110 | WP_000675867.1 | tyrosine-type recombinase/integrase | - |
| PGS39_RS10860 (PGS39_10860) | - | 2097726..2098919 (+) | 1194 | WP_000803131.1 | AimR family lysis-lysogeny pheromone receptor | - |
| PGS39_RS10865 (PGS39_10865) | - | 2099157..2099291 (+) | 135 | WP_000650968.1 | hypothetical protein | - |
| PGS39_RS10870 (PGS39_10870) | - | 2099328..2099681 (-) | 354 | WP_000481767.1 | helix-turn-helix domain-containing protein | - |
| PGS39_RS10875 (PGS39_10875) | - | 2099883..2100068 (+) | 186 | WP_000854265.1 | helix-turn-helix domain-containing protein | - |
| PGS39_RS10880 (PGS39_10880) | - | 2100224..2100499 (+) | 276 | WP_033670234.1 | helix-turn-helix domain-containing protein | - |
| PGS39_RS10885 (PGS39_10885) | - | 2100555..2100719 (+) | 165 | WP_000390319.1 | hypothetical protein | - |
| PGS39_RS10890 (PGS39_10890) | - | 2100749..2100925 (+) | 177 | WP_001241127.1 | hypothetical protein | - |
| PGS39_RS10895 (PGS39_10895) | - | 2100930..2101814 (+) | 885 | WP_001992781.1 | conserved phage C-terminal domain-containing protein | - |
| PGS39_RS10900 (PGS39_10900) | - | 2101829..2102743 (+) | 915 | WP_001171109.1 | AAA family ATPase | - |
| PGS39_RS10905 (PGS39_10905) | - | 2102756..2102950 (+) | 195 | WP_000338031.1 | hypothetical protein | - |
| PGS39_RS10910 (PGS39_10910) | abrB | 2102967..2103245 (+) | 279 | WP_000799086.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| PGS39_RS10915 (PGS39_10915) | - | 2103238..2103597 (+) | 360 | WP_001125952.1 | hypothetical protein | - |
| PGS39_RS10920 (PGS39_10920) | - | 2103616..2103783 (+) | 168 | WP_000717826.1 | DUF3954 domain-containing protein | - |
| PGS39_RS10925 (PGS39_10925) | - | 2103809..2104060 (+) | 252 | WP_000109486.1 | hypothetical protein | - |
| PGS39_RS10930 (PGS39_10930) | - | 2104080..2104562 (+) | 483 | WP_001102009.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| PGS39_RS10935 (PGS39_10935) | - | 2104957..2105355 (+) | 399 | WP_001208936.1 | YopX family protein | - |
| PGS39_RS10940 (PGS39_10940) | - | 2105428..2105694 (+) | 267 | Protein_2068 | YopX family protein | - |
| PGS39_RS10945 (PGS39_10945) | - | 2105752..2106057 (+) | 306 | WP_033679841.1 | hypothetical protein | - |
| PGS39_RS10950 (PGS39_10950) | - | 2106374..2106595 (+) | 222 | WP_001216585.1 | hypothetical protein | - |
| PGS39_RS10955 (PGS39_10955) | - | 2106761..2106958 (+) | 198 | WP_014297965.1 | hypothetical protein | - |
| PGS39_RS10960 (PGS39_10960) | - | 2106997..2107260 (+) | 264 | WP_000678893.1 | hypothetical protein | - |
| PGS39_RS10965 (PGS39_10965) | - | 2107358..2107633 (+) | 276 | WP_000389465.1 | hypothetical protein | - |
| PGS39_RS10970 (PGS39_10970) | - | 2108311..2108442 (+) | 132 | WP_001061241.1 | DUF3983 domain-containing protein | - |
| PGS39_RS10975 (PGS39_10975) | - | 2108547..2108717 (+) | 171 | WP_000645945.1 | hypothetical protein | - |
| PGS39_RS10980 (PGS39_10980) | - | 2108741..2109214 (+) | 474 | WP_001209121.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| PGS39_RS10985 (PGS39_10985) | - | 2109211..2109753 (+) | 543 | WP_001055139.1 | tyrosine-type recombinase/integrase | - |
| PGS39_RS10990 (PGS39_10990) | - | 2110184..2110402 (+) | 219 | Protein_2078 | hypothetical protein | - |
| PGS39_RS10995 (PGS39_10995) | - | 2110395..2110649 (+) | 255 | WP_000002728.1 | hypothetical protein | - |
| PGS39_RS11000 (PGS39_11000) | - | 2110673..2110885 (+) | 213 | WP_000761540.1 | hypothetical protein | - |
| PGS39_RS11005 (PGS39_11005) | - | 2111018..2111191 (+) | 174 | WP_000333204.1 | hypothetical protein | - |
| PGS39_RS11010 (PGS39_11010) | - | 2111184..2111546 (+) | 363 | WP_001008170.1 | HNH endonuclease | - |
| PGS39_RS11015 (PGS39_11015) | - | 2111707..2112087 (+) | 381 | WP_000357495.1 | phage terminase small subunit P27 family | - |
| PGS39_RS11020 (PGS39_11020) | - | 2112068..2113840 (+) | 1773 | WP_271292909.1 | terminase large subunit | - |
| PGS39_RS11025 (PGS39_11025) | - | 2113856..2115070 (+) | 1215 | WP_000767176.1 | phage portal protein | - |
| PGS39_RS11030 (PGS39_11030) | - | 2115048..2115803 (+) | 756 | WP_001107318.1 | head maturation protease, ClpP-related | - |
| PGS39_RS11035 (PGS39_11035) | - | 2115800..2116987 (+) | 1188 | WP_000782636.1 | phage major capsid protein | - |
| PGS39_RS11040 (PGS39_11040) | - | 2117013..2117264 (+) | 252 | Protein_2088 | fibronectin type III domain-containing protein | - |
| PGS39_RS11045 (PGS39_11045) | - | 2117273..2117548 (+) | 276 | WP_000891187.1 | head-tail connector protein | - |
| PGS39_RS11050 (PGS39_11050) | - | 2117535..2117882 (+) | 348 | WP_033679186.1 | phage head closure protein | - |
| PGS39_RS11055 (PGS39_11055) | - | 2117870..2118307 (+) | 438 | WP_000852722.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| PGS39_RS11060 (PGS39_11060) | - | 2118304..2118663 (+) | 360 | WP_001211423.1 | hypothetical protein | - |
| PGS39_RS11065 (PGS39_11065) | - | 2118677..2119261 (+) | 585 | WP_000952020.1 | major tail protein | - |
| PGS39_RS11070 (PGS39_11070) | gpG | 2119322..2119717 (+) | 396 | WP_001157384.1 | phage tail assembly chaperone G | - |
| PGS39_RS11075 (PGS39_11075) | - | 2119735..2119875 (+) | 141 | WP_000938712.1 | hypothetical protein | - |
| PGS39_RS31610 | - | 2119891..2124905 (+) | 5015 | Protein_2096 | phage tail tape measure protein | - |
| PGS39_RS11090 (PGS39_11090) | - | 2124942..2126423 (+) | 1482 | WP_000094083.1 | distal tail protein Dit | - |
| PGS39_RS11095 (PGS39_11095) | - | 2126420..2130433 (+) | 4014 | WP_001260157.1 | phage tail spike protein | - |
| PGS39_RS11100 (PGS39_11100) | - | 2130456..2130905 (+) | 450 | WP_001051330.1 | hypothetical protein | - |
| PGS39_RS11105 (PGS39_11105) | - | 2131143..2132102 (+) | 960 | WP_000822826.1 | tyrosine-type recombinase/integrase | - |
| PGS39_RS11110 (PGS39_11110) | - | 2132118..2132558 (+) | 441 | WP_000373897.1 | phage holin family protein | - |
| PGS39_RS11115 (PGS39_11115) | - | 2132558..2133313 (+) | 756 | WP_000403930.1 | N-acetylmuramoyl-L-alanine amidase | - |
| PGS39_RS11120 (PGS39_11120) | - | 2133356..2133562 (-) | 207 | WP_000340446.1 | helix-turn-helix transcriptional regulator | - |
| PGS39_RS11125 (PGS39_11125) | - | 2133867..2134259 (+) | 393 | WP_000427397.1 | hypothetical protein | - |
| PGS39_RS11130 (PGS39_11130) | - | 2134272..2134598 (+) | 327 | WP_000488699.1 | hypothetical protein | - |
| PGS39_RS11135 (PGS39_11135) | - | 2134608..2135765 (+) | 1158 | WP_002027563.1 | FtsK/SpoIIIE domain-containing protein | - |
| PGS39_RS11140 (PGS39_11140) | - | 2135755..2136405 (+) | 651 | WP_042469569.1 | replication-relaxation family protein | - |
| PGS39_RS11145 (PGS39_11145) | - | 2136426..2136641 (+) | 216 | WP_001287580.1 | hypothetical protein | - |
| PGS39_RS11150 (PGS39_11150) | - | 2136694..2137287 (-) | 594 | WP_000473087.1 | hypothetical protein | - |
| PGS39_RS11155 (PGS39_11155) | - | 2137712..2137933 (+) | 222 | Protein_2110 | VOC family protein | - |
| PGS39_RS11160 (PGS39_11160) | - | 2137978..2138616 (-) | 639 | WP_000535597.1 | zinc dependent phospholipase C family protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10030.62 Da Isoelectric Point: 8.0774
>NTDB_id=776146 PGS39_RS10910 WP_000799086.1 2102967..2103245(+) (abrB) [Bacillus paranthracis strain NVH_0075/95]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALNFHVDGENIVLRKHEKSCFVTGEVSESNMELLGGRMFLSKAGANEL
LNALEKSVKVHA
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALNFHVDGENIVLRKHEKSCFVTGEVSESNMELLGGRMFLSKAGANEL
LNALEKSVKVHA
Nucleotide
Download Length: 279 bp
>NTDB_id=776146 PGS39_RS10910 WP_000799086.1 2102967..2103245(+) (abrB) [Bacillus paranthracis strain NVH_0075/95]
ATGAAAAATACAGGTGTTGCAAGAAAAGTAGATGAACTAGGGCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTGGG
GATTGCTGAAGGAACAGCATTAAACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGTTTTG
TAACAGGTGAAGTTTCTGAATCAAACATGGAATTGTTAGGTGGTCGAATGTTTTTGAGTAAGGCGGGAGCAAATGAGTTA
CTTAATGCTCTTGAAAAGAGCGTGAAGGTACATGCCTAA
ATGAAAAATACAGGTGTTGCAAGAAAAGTAGATGAACTAGGGCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTGGG
GATTGCTGAAGGAACAGCATTAAACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGTTTTG
TAACAGGTGAAGTTTCTGAATCAAACATGGAATTGTTAGGTGGTCGAATGTTTTTGAGTAAGGCGGGAGCAAATGAGTTA
CTTAATGCTCTTGAAAAGAGCGTGAAGGTACATGCCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
54.945 |
98.913 |
0.543 |