Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   PF986_RS07285 Genome accession   NZ_CP116013
Coordinates   1573364..1573630 (-) Length   88 a.a.
NCBI ID   WP_050496152.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM124349     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1568364..1578630
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF986_RS07235 (PF986_07235) sinR 1568527..1568862 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PF986_RS07240 (PF986_07240) tasA 1568910..1569695 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  PF986_RS07245 (PF986_07245) sipW 1569760..1570344 (-) 585 WP_012117977.1 signal peptidase I SipW -
  PF986_RS07250 (PF986_07250) tapA 1570316..1570987 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  PF986_RS07255 (PF986_07255) - 1571246..1571575 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  PF986_RS07260 (PF986_07260) - 1571616..1571795 (-) 180 WP_003153093.1 YqzE family protein -
  PF986_RS07265 (PF986_07265) comGG 1571852..1572229 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  PF986_RS07270 (PF986_07270) comGF 1572230..1572625 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  PF986_RS07275 (PF986_07275) comGE 1572639..1572953 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  PF986_RS07280 (PF986_07280) comGD 1572937..1573374 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  PF986_RS07285 (PF986_07285) comGC 1573364..1573630 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  PF986_RS07290 (PF986_07290) comGB 1573677..1574714 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  PF986_RS07295 (PF986_07295) comGA 1574701..1575771 (-) 1071 WP_106067891.1 competence type IV pilus ATPase ComGA Machinery gene
  PF986_RS07300 (PF986_07300) - 1575963..1576913 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -
  PF986_RS07305 (PF986_07305) - 1577059..1578360 (+) 1302 WP_070082114.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9740.36 Da        Isoelectric Point: 6.4456

>NTDB_id=775182 PF986_RS07285 WP_050496152.1 1573364..1573630(-) (comGC) [Bacillus velezensis strain SRCM124349]
MLIVLFIVSILLLITIPNVTKHNQSIQRKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=775182 PF986_RS07285 WP_050496152.1 1573364..1573630(-) (comGC) [Bacillus velezensis strain SRCM124349]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCGTAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

73.611

81.818

0.602