Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | PF986_RS07230 | Genome accession | NZ_CP116013 |
| Coordinates | 1568320..1568493 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain SRCM124349 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1563320..1573493
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF986_RS07215 (PF986_07215) | gcvT | 1564137..1565237 (-) | 1101 | WP_058906182.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| PF986_RS07220 (PF986_07220) | - | 1565661..1567331 (+) | 1671 | WP_260654657.1 | DEAD/DEAH box helicase | - |
| PF986_RS07225 (PF986_07225) | - | 1567349..1568143 (+) | 795 | WP_260654656.1 | YqhG family protein | - |
| PF986_RS07230 (PF986_07230) | sinI | 1568320..1568493 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| PF986_RS07235 (PF986_07235) | sinR | 1568527..1568862 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| PF986_RS07240 (PF986_07240) | tasA | 1568910..1569695 (-) | 786 | WP_017418136.1 | biofilm matrix protein TasA | - |
| PF986_RS07245 (PF986_07245) | sipW | 1569760..1570344 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| PF986_RS07250 (PF986_07250) | tapA | 1570316..1570987 (-) | 672 | WP_025649852.1 | amyloid fiber anchoring/assembly protein TapA | - |
| PF986_RS07255 (PF986_07255) | - | 1571246..1571575 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| PF986_RS07260 (PF986_07260) | - | 1571616..1571795 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| PF986_RS07265 (PF986_07265) | comGG | 1571852..1572229 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| PF986_RS07270 (PF986_07270) | comGF | 1572230..1572625 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| PF986_RS07275 (PF986_07275) | comGE | 1572639..1572953 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| PF986_RS07280 (PF986_07280) | comGD | 1572937..1573374 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=775177 PF986_RS07230 WP_014418369.1 1568320..1568493(+) (sinI) [Bacillus velezensis strain SRCM124349]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=775177 PF986_RS07230 WP_014418369.1 1568320..1568493(+) (sinI) [Bacillus velezensis strain SRCM124349]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |