Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   PF986_RS07230 Genome accession   NZ_CP116013
Coordinates   1568320..1568493 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain SRCM124349     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1563320..1573493
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF986_RS07215 (PF986_07215) gcvT 1564137..1565237 (-) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -
  PF986_RS07220 (PF986_07220) - 1565661..1567331 (+) 1671 WP_260654657.1 DEAD/DEAH box helicase -
  PF986_RS07225 (PF986_07225) - 1567349..1568143 (+) 795 WP_260654656.1 YqhG family protein -
  PF986_RS07230 (PF986_07230) sinI 1568320..1568493 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  PF986_RS07235 (PF986_07235) sinR 1568527..1568862 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PF986_RS07240 (PF986_07240) tasA 1568910..1569695 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  PF986_RS07245 (PF986_07245) sipW 1569760..1570344 (-) 585 WP_012117977.1 signal peptidase I SipW -
  PF986_RS07250 (PF986_07250) tapA 1570316..1570987 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  PF986_RS07255 (PF986_07255) - 1571246..1571575 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  PF986_RS07260 (PF986_07260) - 1571616..1571795 (-) 180 WP_003153093.1 YqzE family protein -
  PF986_RS07265 (PF986_07265) comGG 1571852..1572229 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  PF986_RS07270 (PF986_07270) comGF 1572230..1572625 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  PF986_RS07275 (PF986_07275) comGE 1572639..1572953 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  PF986_RS07280 (PF986_07280) comGD 1572937..1573374 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=775177 PF986_RS07230 WP_014418369.1 1568320..1568493(+) (sinI) [Bacillus velezensis strain SRCM124349]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=775177 PF986_RS07230 WP_014418369.1 1568320..1568493(+) (sinI) [Bacillus velezensis strain SRCM124349]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719