Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   PF976_RS15370 Genome accession   NZ_CP116011
Coordinates   2950097..2950237 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus amyloliquefaciens strain SRCM124317     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2945097..2955237
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF976_RS15345 (PF976_15345) - 2945416..2945799 (-) 384 WP_013353393.1 hotdog fold thioesterase -
  PF976_RS15350 (PF976_15350) comA 2945821..2946465 (-) 645 WP_014472195.1 response regulator transcription factor Regulator
  PF976_RS15355 (PF976_15355) comP 2946546..2948852 (-) 2307 WP_013353395.1 sensor histidine kinase Regulator
  PF976_RS15360 (PF976_15360) comX 2948875..2949051 (-) 177 WP_013353396.1 competence pheromone ComX -
  PF976_RS15365 (PF976_15365) - 2949070..2949945 (-) 876 WP_013353397.1 polyprenyl synthetase family protein -
  PF976_RS15370 (PF976_15370) degQ 2950097..2950237 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  PF976_RS15375 (PF976_15375) - 2950702..2951043 (+) 342 WP_013353399.1 hypothetical protein -
  PF976_RS15380 (PF976_15380) - 2951050..2952273 (-) 1224 WP_013353400.1 EAL and HDOD domain-containing protein -
  PF976_RS15385 (PF976_15385) - 2952403..2953869 (-) 1467 WP_014472199.1 nicotinate phosphoribosyltransferase -
  PF976_RS15390 (PF976_15390) - 2953887..2954438 (-) 552 WP_013353402.1 cysteine hydrolase family protein -
  PF976_RS15395 (PF976_15395) - 2954519..2954914 (-) 396 WP_013353403.1 YueI family protein -
  PF976_RS15400 (PF976_15400) - 2954980..2955228 (-) 249 WP_013353404.1 YueH family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=775056 PF976_RS15370 WP_013353398.1 2950097..2950237(-) (degQ) [Bacillus amyloliquefaciens strain SRCM124317]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=775056 PF976_RS15370 WP_013353398.1 2950097..2950237(-) (degQ) [Bacillus amyloliquefaciens strain SRCM124317]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P06532

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913