Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   PF975_RS17890 Genome accession   NZ_CP116010
Coordinates   3637592..3637711 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain SRCM123815     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3632592..3642711
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF975_RS17865 (PF975_17865) - 3632831..3633589 (-) 759 WP_012116804.1 ABC transporter ATP-binding protein -
  PF975_RS17870 (PF975_17870) - 3633583..3634530 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  PF975_RS17875 (PF975_17875) ceuB 3634520..3635473 (-) 954 WP_014416904.1 ABC transporter permease Machinery gene
  PF975_RS17880 (PF975_17880) - 3635887..3637251 (+) 1365 WP_014416903.1 aspartate kinase -
  PF975_RS17885 (PF975_17885) - 3637331..3637441 (+) 111 WP_369878517.1 YjcZ family sporulation protein -
  PF975_RS17890 (PF975_17890) phrC 3637592..3637711 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  PF975_RS17895 (PF975_17895) rapC 3637695..3638843 (-) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  PF975_RS17900 (PF975_17900) - 3639002..3640429 (-) 1428 WP_088056326.1 sensor histidine kinase -
  PF975_RS17905 (PF975_17905) - 3640416..3641099 (-) 684 WP_014416901.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=774990 PF975_RS17890 WP_003156334.1 3637592..3637711(-) (phrC) [Bacillus velezensis strain SRCM123815]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=774990 PF975_RS17890 WP_003156334.1 3637592..3637711(-) (phrC) [Bacillus velezensis strain SRCM123815]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718