Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   PF975_RS07925 Genome accession   NZ_CP116010
Coordinates   1549131..1549304 (-) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain SRCM123815     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1544131..1554304
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF975_RS07875 (PF975_07875) comGD 1544250..1544687 (+) 438 WP_088056451.1 competence type IV pilus minor pilin ComGD Machinery gene
  PF975_RS07880 (PF975_07880) comGE 1544671..1544985 (+) 315 WP_088056452.1 competence type IV pilus minor pilin ComGE -
  PF975_RS07885 (PF975_07885) comGF 1544999..1545394 (+) 396 WP_088056453.1 competence type IV pilus minor pilin ComGF -
  PF975_RS07890 (PF975_07890) comGG 1545395..1545772 (+) 378 WP_053284923.1 competence type IV pilus minor pilin ComGG Machinery gene
  PF975_RS07895 (PF975_07895) - 1545829..1546008 (+) 180 WP_003153093.1 YqzE family protein -
  PF975_RS07900 (PF975_07900) - 1546049..1546378 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  PF975_RS07905 (PF975_07905) tapA 1546637..1547308 (+) 672 WP_053284922.1 amyloid fiber anchoring/assembly protein TapA -
  PF975_RS07910 (PF975_07910) sipW 1547280..1547864 (+) 585 WP_012117977.1 signal peptidase I SipW -
  PF975_RS07915 (PF975_07915) tasA 1547929..1548714 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  PF975_RS07920 (PF975_07920) sinR 1548762..1549097 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PF975_RS07925 (PF975_07925) sinI 1549131..1549304 (-) 174 WP_014418369.1 anti-repressor SinI Regulator
  PF975_RS07930 (PF975_07930) - 1549481..1550275 (-) 795 WP_014418368.1 YqhG family protein -
  PF975_RS07935 (PF975_07935) - 1550297..1551967 (-) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  PF975_RS07940 (PF975_07940) gcvT 1552391..1553491 (+) 1101 WP_014418366.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=774961 PF975_RS07925 WP_014418369.1 1549131..1549304(-) (sinI) [Bacillus velezensis strain SRCM123815]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=774961 PF975_RS07925 WP_014418369.1 1549131..1549304(-) (sinI) [Bacillus velezensis strain SRCM123815]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719