Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   PF975_RS07870 Genome accession   NZ_CP116010
Coordinates   1543994..1544260 (+) Length   88 a.a.
NCBI ID   WP_050496152.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM123815     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1538994..1549260
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF975_RS07850 (PF975_07850) - 1539263..1540564 (-) 1302 WP_029973873.1 hemolysin family protein -
  PF975_RS07855 (PF975_07855) - 1540710..1541660 (+) 951 WP_014418379.1 magnesium transporter CorA family protein -
  PF975_RS07860 (PF975_07860) comGA 1541853..1542923 (+) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  PF975_RS07865 (PF975_07865) comGB 1542910..1543947 (+) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  PF975_RS07870 (PF975_07870) comGC 1543994..1544260 (+) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  PF975_RS07875 (PF975_07875) comGD 1544250..1544687 (+) 438 WP_088056451.1 competence type IV pilus minor pilin ComGD Machinery gene
  PF975_RS07880 (PF975_07880) comGE 1544671..1544985 (+) 315 WP_088056452.1 competence type IV pilus minor pilin ComGE -
  PF975_RS07885 (PF975_07885) comGF 1544999..1545394 (+) 396 WP_088056453.1 competence type IV pilus minor pilin ComGF -
  PF975_RS07890 (PF975_07890) comGG 1545395..1545772 (+) 378 WP_053284923.1 competence type IV pilus minor pilin ComGG Machinery gene
  PF975_RS07895 (PF975_07895) - 1545829..1546008 (+) 180 WP_003153093.1 YqzE family protein -
  PF975_RS07900 (PF975_07900) - 1546049..1546378 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  PF975_RS07905 (PF975_07905) tapA 1546637..1547308 (+) 672 WP_053284922.1 amyloid fiber anchoring/assembly protein TapA -
  PF975_RS07910 (PF975_07910) sipW 1547280..1547864 (+) 585 WP_012117977.1 signal peptidase I SipW -
  PF975_RS07915 (PF975_07915) tasA 1547929..1548714 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  PF975_RS07920 (PF975_07920) sinR 1548762..1549097 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9740.36 Da        Isoelectric Point: 6.4456

>NTDB_id=774957 PF975_RS07870 WP_050496152.1 1543994..1544260(+) (comGC) [Bacillus velezensis strain SRCM123815]
MLIVLFIVSILLLITIPNVTKHNQSIQRKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=774957 PF975_RS07870 WP_050496152.1 1543994..1544260(+) (comGC) [Bacillus velezensis strain SRCM123815]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCGTAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

73.611

81.818

0.602