Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | PFY08_RS12660 | Genome accession | NZ_CP115856 |
| Coordinates | 2474260..2474538 (+) | Length | 92 a.a. |
| NCBI ID | WP_086402203.1 | Uniprot ID | A0A9X6L9L9 |
| Organism | Bacillus cereus strain PL22-16A | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2463918..2506164 | 2474260..2474538 | within | 0 |
Gene organization within MGE regions
Location: 2463918..2506164
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PFY08_RS12585 (PFY08_12585) | - | 2463918..2464181 (+) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
| PFY08_RS12590 (PFY08_12590) | - | 2464738..2465049 (+) | 312 | WP_001071365.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| PFY08_RS12595 (PFY08_12595) | - | 2465195..2465329 (+) | 135 | Protein_2410 | site-specific integrase | - |
| PFY08_RS12600 (PFY08_12600) | - | 2465539..2466024 (+) | 486 | WP_002041181.1 | hypothetical protein | - |
| PFY08_RS12605 (PFY08_12605) | - | 2466336..2467037 (+) | 702 | WP_271143437.1 | pPIWI_RE module domain-containing protein | - |
| PFY08_RS12610 (PFY08_12610) | - | 2467076..2468185 (-) | 1110 | WP_086402207.1 | tyrosine-type recombinase/integrase | - |
| PFY08_RS12615 (PFY08_12615) | - | 2468489..2469700 (+) | 1212 | WP_271143438.1 | exosporium leader peptide-containing protein | - |
| PFY08_RS12620 (PFY08_12620) | - | 2470254..2471405 (+) | 1152 | WP_271143439.1 | AimR family lysis-lysogeny pheromone receptor | - |
| PFY08_RS12625 (PFY08_12625) | - | 2471443..2471589 (+) | 147 | WP_000720927.1 | hypothetical protein | - |
| PFY08_RS12630 (PFY08_12630) | - | 2471745..2471873 (+) | 129 | WP_254914087.1 | hypothetical protein | - |
| PFY08_RS12635 (PFY08_12635) | - | 2471909..2472262 (-) | 354 | WP_000491272.1 | helix-turn-helix domain-containing protein | - |
| PFY08_RS12640 (PFY08_12640) | - | 2472462..2472653 (+) | 192 | WP_000854271.1 | helix-turn-helix domain-containing protein | - |
| PFY08_RS12645 (PFY08_12645) | - | 2472710..2472976 (+) | 267 | WP_000522028.1 | helix-turn-helix domain-containing protein | - |
| PFY08_RS12650 (PFY08_12650) | - | 2472976..2473140 (+) | 165 | WP_000390285.1 | hypothetical protein | - |
| PFY08_RS12655 (PFY08_12655) | - | 2473198..2474256 (+) | 1059 | WP_271143440.1 | DnaD domain-containing protein | - |
| PFY08_RS12660 (PFY08_12660) | abrB | 2474260..2474538 (+) | 279 | WP_086402203.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| PFY08_RS12665 (PFY08_12665) | - | 2474531..2474890 (+) | 360 | WP_086402202.1 | cell division protein SepF | - |
| PFY08_RS12670 (PFY08_12670) | - | 2474909..2475076 (+) | 168 | WP_000717825.1 | DUF3954 domain-containing protein | - |
| PFY08_RS12675 (PFY08_12675) | - | 2475102..2475353 (+) | 252 | WP_271143441.1 | helix-turn-helix domain containing protein | - |
| PFY08_RS12680 (PFY08_12680) | - | 2475373..2475828 (+) | 456 | WP_271143442.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| PFY08_RS12685 (PFY08_12685) | - | 2476041..2476769 (-) | 729 | WP_271143443.1 | glycosyltransferase family 2 protein | - |
| PFY08_RS12690 (PFY08_12690) | - | 2477045..2477833 (-) | 789 | WP_271143444.1 | sulfotransferase family 2 domain-containing protein | - |
| PFY08_RS12695 (PFY08_12695) | - | 2479069..2479233 (-) | 165 | WP_271143445.1 | hypothetical protein | - |
| PFY08_RS12700 (PFY08_12700) | - | 2479443..2479565 (+) | 123 | WP_081367280.1 | DUF3983 domain-containing protein | - |
| PFY08_RS12705 (PFY08_12705) | - | 2479681..2479851 (+) | 171 | WP_086401737.1 | hypothetical protein | - |
| PFY08_RS12710 (PFY08_12710) | - | 2479879..2480361 (+) | 483 | WP_086401736.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| PFY08_RS12715 (PFY08_12715) | - | 2480361..2480903 (+) | 543 | WP_086401735.1 | site-specific integrase | - |
| PFY08_RS12720 (PFY08_12720) | - | 2481268..2482905 (+) | 1638 | WP_271143446.1 | sialidase family protein | - |
| PFY08_RS12725 (PFY08_12725) | - | 2483321..2484112 (+) | 792 | WP_271143447.1 | hypothetical protein | - |
| PFY08_RS12730 (PFY08_12730) | - | 2484434..2485879 (-) | 1446 | WP_271143448.1 | HEPN domain-containing protein | - |
| PFY08_RS12735 (PFY08_12735) | - | 2486217..2486555 (+) | 339 | WP_271143449.1 | HNH endonuclease | - |
| PFY08_RS12740 (PFY08_12740) | - | 2486705..2487040 (+) | 336 | WP_271143450.1 | P27 family phage terminase small subunit | - |
| PFY08_RS12745 (PFY08_12745) | - | 2487037..2488695 (+) | 1659 | WP_000615659.1 | terminase TerL endonuclease subunit | - |
| PFY08_RS12750 (PFY08_12750) | - | 2488704..2489867 (+) | 1164 | WP_416358661.1 | phage portal protein | - |
| PFY08_RS12755 (PFY08_12755) | - | 2489851..2490627 (+) | 777 | WP_000216402.1 | head maturation protease, ClpP-related | - |
| PFY08_RS12760 (PFY08_12760) | - | 2490647..2491810 (+) | 1164 | WP_271143451.1 | phage major capsid protein | - |
| PFY08_RS12765 (PFY08_12765) | - | 2491823..2492116 (+) | 294 | WP_271143452.1 | hypothetical protein | - |
| PFY08_RS12770 (PFY08_12770) | - | 2492118..2492471 (+) | 354 | WP_271143453.1 | phage head closure protein | - |
| PFY08_RS12775 (PFY08_12775) | - | 2492473..2492817 (+) | 345 | WP_271143454.1 | HK97 gp10 family phage protein | - |
| PFY08_RS12780 (PFY08_12780) | - | 2492814..2493143 (+) | 330 | WP_271143455.1 | hypothetical protein | - |
| PFY08_RS12785 (PFY08_12785) | - | 2493144..2493737 (+) | 594 | WP_271143456.1 | major tail protein | - |
| PFY08_RS12790 (PFY08_12790) | - | 2493744..2494100 (+) | 357 | WP_000415935.1 | hypothetical protein | - |
| PFY08_RS12795 (PFY08_12795) | - | 2494331..2495539 (+) | 1209 | Protein_2450 | hypothetical protein | - |
| PFY08_RS12800 (PFY08_12800) | - | 2495797..2496054 (+) | 258 | WP_271143457.1 | hypothetical protein | - |
| PFY08_RS12805 (PFY08_12805) | - | 2496278..2498467 (+) | 2190 | WP_271143458.1 | phage tail protein | - |
| PFY08_RS12810 (PFY08_12810) | - | 2498509..2499972 (+) | 1464 | WP_271143459.1 | distal tail protein Dit | - |
| PFY08_RS12815 (PFY08_12815) | - | 2499969..2504492 (+) | 4524 | WP_271143460.1 | phage tail spike protein | - |
| PFY08_RS12820 (PFY08_12820) | - | 2504508..2504870 (+) | 363 | WP_271143461.1 | hypothetical protein | - |
| PFY08_RS12825 (PFY08_12825) | - | 2504908..2505192 (+) | 285 | WP_000435483.1 | hypothetical protein | - |
| PFY08_RS12830 (PFY08_12830) | - | 2505207..2505437 (+) | 231 | WP_001243443.1 | phage holin | - |
| PFY08_RS12835 (PFY08_12835) | - | 2505454..2506164 (+) | 711 | WP_271143462.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10253.93 Da Isoelectric Point: 5.7255
>NTDB_id=773998 PFY08_RS12660 WP_086402203.1 2474260..2474538(+) (abrB) [Bacillus cereus strain PL22-16A]
MKNKGVARKVDELGRIVIPVELRRNLGIVEGTTLDFHIEGENIVLRKYENSCFVTGEVSETNIELLGGRMFLSKEGIIEL
LDLIQKSGMAHA
MKNKGVARKVDELGRIVIPVELRRNLGIVEGTTLDFHIEGENIVLRKYENSCFVTGEVSETNIELLGGRMFLSKEGIIEL
LDLIQKSGMAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=773998 PFY08_RS12660 WP_086402203.1 2474260..2474538(+) (abrB) [Bacillus cereus strain PL22-16A]
ATGAAAAACAAAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTATAGTAATTCCAGTAGAGTTACGCAGAAATTTAGG
GATTGTCGAAGGAACGACACTAGATTTTCATATCGAGGGTGAAAACATTGTTCTAAGAAAATATGAAAACTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGATAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
ATGAAAAACAAAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTATAGTAATTCCAGTAGAGTTACGCAGAAATTTAGG
GATTGTCGAAGGAACGACACTAGATTTTCATATCGAGGGTGAAAACATTGTTCTAAGAAAATATGAAAACTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGATAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
52.874 |
94.565 |
0.5 |