Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   QTN45_RS17820 Genome accession   NZ_CP128500
Coordinates   3450312..3450431 (-) Length   39 a.a.
NCBI ID   WP_013351005.1    Uniprot ID   A0A150F3U5
Organism   Bacillus amyloliquefaciens strain SRCM123364     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3445312..3455431
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN45_RS17795 (QTN45_17795) - 3445548..3446306 (-) 759 WP_013351009.1 ABC transporter ATP-binding protein -
  QTN45_RS17800 (QTN45_17800) - 3446300..3447247 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  QTN45_RS17805 (QTN45_17805) ceuB 3447237..3448190 (-) 954 WP_013351008.1 ABC transporter permease Machinery gene
  QTN45_RS17810 (QTN45_17810) - 3448604..3449968 (+) 1365 WP_289412533.1 aspartate kinase -
  QTN45_RS17815 (QTN45_17815) - 3450063..3450164 (+) 102 WP_013351006.1 YjcZ family sporulation protein -
  QTN45_RS17820 (QTN45_17820) phrC 3450312..3450431 (-) 120 WP_013351005.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  QTN45_RS17825 (QTN45_17825) rapC 3450415..3451563 (-) 1149 WP_013351004.1 tetratricopeptide repeat protein Regulator
  QTN45_RS17830 (QTN45_17830) - 3451722..3453149 (-) 1428 WP_161988189.1 HAMP domain-containing sensor histidine kinase -
  QTN45_RS17835 (QTN45_17835) - 3453136..3453819 (-) 684 WP_013351002.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=773947 QTN45_RS17820 WP_013351005.1 3450312..3450431(-) (phrC) [Bacillus amyloliquefaciens strain SRCM123364]
MKLKSKWFVICLAAAAIFTAAGVSQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=773947 QTN45_RS17820 WP_013351005.1 3450312..3450431(-) (phrC) [Bacillus amyloliquefaciens strain SRCM123364]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGCTGCAGGTGTAAGCCAGACAGA
TCAGGCTGAATTCCATGTGGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A150F3U5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

80

100

0.821