Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   QTN45_RS07765 Genome accession   NZ_CP128500
Coordinates   1488659..1488973 (+) Length   104 a.a.
NCBI ID   WP_014470662.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain SRCM123364     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1483659..1493973
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN45_RS07740 (QTN45_07740) - 1484697..1485647 (+) 951 WP_013352873.1 magnesium transporter CorA family protein -
  QTN45_RS07745 (QTN45_07745) comGA 1485841..1486911 (+) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  QTN45_RS07750 (QTN45_07750) comGB 1486898..1487935 (+) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  QTN45_RS07755 (QTN45_07755) comGC 1487982..1488248 (+) 267 WP_044051905.1 competence type IV pilus major pilin ComGC Machinery gene
  QTN45_RS07760 (QTN45_07760) comGD 1488238..1488675 (+) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  QTN45_RS07765 (QTN45_07765) comGE 1488659..1488973 (+) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  QTN45_RS07770 (QTN45_07770) comGF 1488978..1489382 (+) 405 WP_289413132.1 competence type IV pilus minor pilin ComGF Machinery gene
  QTN45_RS07775 (QTN45_07775) comGG 1489384..1489761 (+) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  QTN45_RS07780 (QTN45_07780) - 1489815..1489994 (+) 180 WP_013352866.1 YqzE family protein -
  QTN45_RS07785 (QTN45_07785) - 1490035..1490364 (-) 330 WP_013352865.1 DUF3889 domain-containing protein -
  QTN45_RS07790 (QTN45_07790) tapA 1490622..1491293 (+) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  QTN45_RS07795 (QTN45_07795) sipW 1491265..1491849 (+) 585 WP_013352863.1 signal peptidase I SipW -
  QTN45_RS07800 (QTN45_07800) tasA 1491914..1492699 (+) 786 WP_013352862.1 biofilm matrix protein TasA -
  QTN45_RS07805 (QTN45_07805) sinR 1492747..1493082 (-) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  QTN45_RS07810 (QTN45_07810) sinI 1493116..1493289 (-) 174 WP_013352860.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11934.89 Da        Isoelectric Point: 6.2120

>NTDB_id=773877 QTN45_RS07765 WP_014470662.1 1488659..1488973(+) (comGE) [Bacillus amyloliquefaciens strain SRCM123364]
MQNGNKGFSTIETLSAMAIWLFLMISIVPVWTGMLTDNLKIEEHQEVYQLLHKHISAYMMSGKKQPSPDVTWKEDGDYYK
VCAAVRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=773877 QTN45_RS07765 WP_014470662.1 1488659..1488973(+) (comGE) [Bacillus amyloliquefaciens strain SRCM123364]
ATGCAGAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCTATTTGGCTGTTCCTTATGATTTCTAT
CGTTCCGGTCTGGACGGGCATGCTGACAGACAATCTGAAAATAGAAGAACACCAGGAAGTGTACCAGCTTCTTCATAAAC
ATATCAGCGCATATATGATGTCCGGAAAAAAGCAGCCATCTCCCGATGTGACGTGGAAGGAGGATGGTGATTATTACAAA
GTCTGTGCAGCTGTCCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481