Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   OSK17_RS17320 Genome accession   NZ_CP115738
Coordinates   3272736..3272876 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain W7     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3267736..3277876
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OSK17_RS17295 (OSK17_17295) yuxO 3268079..3268459 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  OSK17_RS17300 (OSK17_17300) comA 3268478..3269122 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  OSK17_RS17305 (OSK17_17305) comP 3269203..3271503 (-) 2301 WP_088300729.1 histidine kinase Regulator
  OSK17_RS17310 (OSK17_17310) comX 3271515..3271679 (-) 165 WP_015384519.1 competence pheromone ComX -
  OSK17_RS17315 (OSK17_17315) - 3271692..3272552 (-) 861 WP_041850585.1 polyprenyl synthetase family protein -
  OSK17_RS17320 (OSK17_17320) degQ 3272736..3272876 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  OSK17_RS17325 (OSK17_17325) - 3273098..3273160 (+) 63 Protein_3357 hypothetical protein -
  OSK17_RS17330 (OSK17_17330) - 3273339..3273707 (+) 369 WP_041850584.1 hypothetical protein -
  OSK17_RS17335 (OSK17_17335) pdeH 3273683..3274912 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  OSK17_RS17340 (OSK17_17340) pncB 3275049..3276521 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  OSK17_RS17345 (OSK17_17345) pncA 3276537..3277088 (-) 552 WP_043940186.1 cysteine hydrolase family protein -
  OSK17_RS17350 (OSK17_17350) yueI 3277185..3277583 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=773681 OSK17_RS17320 WP_003220708.1 3272736..3272876(-) (degQ) [Bacillus subtilis strain W7]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=773681 OSK17_RS17320 WP_003220708.1 3272736..3272876(-) (degQ) [Bacillus subtilis strain W7]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1