Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   QQ984_RS13530 Genome accession   NZ_CP127223
Coordinates   2588920..2589357 (-) Length   145 a.a.
NCBI ID   WP_071583679.1    Uniprot ID   -
Organism   Bacillus licheniformis strain Jrh14-10     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2583920..2594357
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QQ984_RS13480 (QQ984_13480) sinI 2584089..2584265 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  QQ984_RS13485 (QQ984_13485) sinR 2584299..2584634 (+) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  QQ984_RS13490 (QQ984_13490) - 2584739..2585533 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  QQ984_RS13495 (QQ984_13495) - 2585607..2586191 (-) 585 WP_003183449.1 signal peptidase I SipW -
  QQ984_RS13500 (QQ984_13500) tapA 2586188..2586916 (-) 729 WP_011198112.1 amyloid fiber anchoring/assembly protein TapA -
  QQ984_RS13505 (QQ984_13505) - 2587226..2587513 (+) 288 WP_223307118.1 YqzG/YhdC family protein -
  QQ984_RS13510 (QQ984_13510) - 2587543..2587725 (-) 183 WP_003183456.1 YqzE family protein -
  QQ984_RS13515 (QQ984_13515) comGG 2587814..2588179 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  QQ984_RS13520 (QQ984_13520) comGF 2588192..2588680 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  QQ984_RS13525 (QQ984_13525) comGE 2588589..2588936 (-) 348 WP_026699160.1 competence type IV pilus minor pilin ComGE -
  QQ984_RS13530 (QQ984_13530) comGD 2588920..2589357 (-) 438 WP_071583679.1 competence type IV pilus minor pilin ComGD Machinery gene
  QQ984_RS13535 (QQ984_13535) comGC 2589363..2589656 (-) 294 WP_003183466.1 competence type IV pilus major pilin ComGC Machinery gene
  QQ984_RS13540 (QQ984_13540) comGB 2589670..2590704 (-) 1035 WP_011198115.1 competence type IV pilus assembly protein ComGB Machinery gene
  QQ984_RS13545 (QQ984_13545) comGA 2590694..2591758 (-) 1065 WP_003183477.1 competence type IV pilus ATPase ComGA Machinery gene
  QQ984_RS13550 (QQ984_13550) - 2591915..2592754 (-) 840 WP_071583678.1 STAS domain-containing protein -
  QQ984_RS13560 (QQ984_13560) - 2592996..2593373 (-) 378 WP_003183482.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  QQ984_RS13565 (QQ984_13565) - 2593582..2593827 (+) 246 WP_003183483.1 DUF2626 domain-containing protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16291.15 Da        Isoelectric Point: 9.6739

>NTDB_id=771490 QQ984_RS13530 WP_071583679.1 2588920..2589357(-) (comGD) [Bacillus licheniformis strain Jrh14-10]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQVGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=771490 QQ984_RS13530 WP_071583679.1 2588920..2589357(-) (comGD) [Bacillus licheniformis strain Jrh14-10]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGTGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

39.161

98.621

0.386