Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ORQ91_RS04325 Genome accession   NZ_CP115172
Coordinates   870315..870455 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain BS-10L     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 865315..875455
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ORQ91_RS04300 (ORQ91_00866) - 865545..865952 (+) 408 WP_103131554.1 YueI family protein -
  ORQ91_RS04305 (ORQ91_00867) - 866013..866564 (+) 552 WP_024425949.1 cysteine hydrolase family protein -
  ORQ91_RS04310 (ORQ91_00868) - 866642..868054 (+) 1413 WP_229137108.1 nicotinate phosphoribosyltransferase -
  ORQ91_RS04315 (ORQ91_00869) - 868191..869417 (+) 1227 WP_024423326.1 EAL and HDOD domain-containing protein -
  ORQ91_RS04320 (ORQ91_00870) - 869453..869809 (-) 357 WP_052503035.1 hypothetical protein -
  ORQ91_RS04325 (ORQ91_00871) degQ 870315..870455 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  ORQ91_RS04330 (ORQ91_00872) - 870607..871521 (+) 915 WP_122632074.1 polyprenyl synthetase family protein -
  ORQ91_RS04335 (ORQ91_00873) - 871518..871685 (+) 168 WP_080696376.1 competence pheromone ComX -
  ORQ91_RS04340 (ORQ91_00874) comP 871748..874060 (+) 2313 WP_270127242.1 ATP-binding protein Regulator
  ORQ91_RS04345 (ORQ91_00875) comA 874141..874782 (+) 642 WP_024423322.1 response regulator transcription factor Regulator
  ORQ91_RS04350 (ORQ91_00876) - 874806..875195 (+) 390 WP_024423321.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=768536 ORQ91_RS04325 WP_003213123.1 870315..870455(+) (degQ) [Bacillus safensis strain BS-10L]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=768536 ORQ91_RS04325 WP_003213123.1 870315..870455(+) (degQ) [Bacillus safensis strain BS-10L]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696