Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | O7R04_RS14250 | Genome accession | NZ_CP115158 |
| Coordinates | 2918073..2918213 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain MBLB 0692 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2913073..2923213
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O7R04_RS14225 (O7R04_14225) | - | 2913414..2913797 (-) | 384 | WP_139885447.1 | hotdog fold thioesterase | - |
| O7R04_RS14230 (O7R04_14230) | comA | 2913819..2914463 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| O7R04_RS14235 (O7R04_14235) | - | 2914544..2916834 (-) | 2291 | Protein_2737 | histidine kinase | - |
| O7R04_RS14240 (O7R04_14240) | comX | 2916846..2917010 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| O7R04_RS14245 (O7R04_14245) | - | 2917010..2917921 (-) | 912 | WP_014305720.1 | polyprenyl synthetase family protein | - |
| O7R04_RS14250 (O7R04_14250) | degQ | 2918073..2918213 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| O7R04_RS14255 (O7R04_14255) | - | 2918679..2919020 (+) | 342 | WP_014305721.1 | hypothetical protein | - |
| O7R04_RS14260 (O7R04_14260) | - | 2919027..2920247 (-) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| O7R04_RS14265 (O7R04_14265) | - | 2920377..2921843 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| O7R04_RS14270 (O7R04_14270) | - | 2921861..2922412 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| O7R04_RS14275 (O7R04_14275) | - | 2922509..2922907 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=768444 O7R04_RS14250 WP_003152043.1 2918073..2918213(-) (degQ) [Bacillus velezensis strain MBLB 0692]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=768444 O7R04_RS14250 WP_003152043.1 2918073..2918213(-) (degQ) [Bacillus velezensis strain MBLB 0692]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |