Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | QPX68_RS11645 | Genome accession | NZ_CP126696 |
| Coordinates | 2435708..2435881 (+) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus amyloliquefaciens strain GZY63 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2430708..2440881
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPX68_RS11630 | gcvT | 2431522..2432622 (-) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| QPX68_RS11635 | - | 2433045..2434715 (+) | 1671 | WP_032874031.1 | SNF2-related protein | - |
| QPX68_RS11640 | - | 2434737..2435531 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| QPX68_RS11645 | sinI | 2435708..2435881 (+) | 174 | WP_032874029.1 | anti-repressor SinI family protein | Regulator |
| QPX68_RS11650 | sinR | 2435915..2436250 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| QPX68_RS11655 | - | 2436298..2437083 (-) | 786 | WP_032874027.1 | TasA family protein | - |
| QPX68_RS11660 | - | 2437148..2437732 (-) | 585 | WP_032874025.1 | signal peptidase I | - |
| QPX68_RS11665 | tapA | 2437704..2438375 (-) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| QPX68_RS11670 | - | 2438634..2438963 (+) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| QPX68_RS11675 | - | 2439004..2439183 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| QPX68_RS11680 | comGG | 2439240..2439617 (-) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| QPX68_RS11685 | comGF | 2439618..2440118 (-) | 501 | WP_223204419.1 | competence type IV pilus minor pilin ComGF | - |
| QPX68_RS11690 | comGE | 2440027..2440341 (-) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| QPX68_RS11695 | comGD | 2440325..2440762 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=768322 QPX68_RS11645 WP_032874029.1 2435708..2435881(+) (sinI) [Bacillus amyloliquefaciens strain GZY63]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=768322 QPX68_RS11645 WP_032874029.1 2435708..2435881(+) (sinI) [Bacillus amyloliquefaciens strain GZY63]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |