Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LLE01_RS12450 Genome accession   NZ_CP126675
Coordinates   2255537..2255821 (-) Length   94 a.a.
NCBI ID   WP_010906314.1    Uniprot ID   Q9CDU4
Organism   Lactococcus lactis subsp. lactis strain E.0.1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2250537..2260821
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLE01_RS12420 (LLE01_12390) - 2250977..2251354 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  LLE01_RS12425 (LLE01_12395) - 2251559..2252425 (+) 867 WP_010906309.1 RluA family pseudouridine synthase -
  LLE01_RS12430 (LLE01_12400) - 2252464..2253273 (-) 810 WP_010906310.1 metal ABC transporter permease -
  LLE01_RS12435 (LLE01_12405) - 2253266..2254003 (-) 738 WP_010906311.1 metal ABC transporter ATP-binding protein -
  LLE01_RS12440 (LLE01_12410) - 2254180..2255022 (-) 843 WP_010906312.1 metal ABC transporter substrate-binding protein -
  LLE01_RS12445 (LLE01_12415) - 2255019..2255456 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  LLE01_RS12450 (LLE01_12420) comGG 2255537..2255821 (-) 285 WP_010906314.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLE01_RS12455 (LLE01_12425) comGF 2255860..2256306 (-) 447 WP_031296844.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLE01_RS12460 (LLE01_12430) comGE 2256269..2256565 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLE01_RS12465 (LLE01_12435) comGD 2256537..2256935 (-) 399 WP_021214886.1 competence type IV pilus minor pilin ComGD Machinery gene
  LLE01_RS12470 (LLE01_12440) comGC 2256928..2257311 (-) 384 WP_010906318.1 competence type IV pilus major pilin ComGC Machinery gene
  LLE01_RS12475 (LLE01_12445) comGB 2257325..2258398 (-) 1074 WP_010906319.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLE01_RS12480 (LLE01_12450) comGA 2258292..2259230 (-) 939 WP_010906320.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=768112 LLE01_RS12450 WP_010906314.1 2255537..2255821(-) (comGG) [Lactococcus lactis subsp. lactis strain E.0.1]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=768112 LLE01_RS12450 WP_010906314.1 2255537..2255821(-) (comGG) [Lactococcus lactis subsp. lactis strain E.0.1]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9CDU4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

59.14

98.936

0.585