Detailed information NTG0765993

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: O3S97_RS06215
• Genome accession: NZ_CP114450
• Coordinates: 1286258..1286575 (+)
• Length: 105 a.a.
• NCBI ID: WP_002446532.1
• Uniprot ID: -
• Organism: Staphylococcus epidermidis strain SE 4.8
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1281258..1291575

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
O3S97_RS06185 (O3S97_06190)	-	1282036..1282236 (+)	201	WP_002446537.1	YqgQ family protein	-
O3S97_RS06190 (O3S97_06195)	-	1282236..1283222 (+)	987	WP_002446536.1	ROK family glucokinase	-
O3S97_RS06195 (O3S97_06200)	-	1283222..1283548 (+)	327	WP_001831234.1	MTH1187 family thiamine-binding protein	-
O3S97_RS06200 (O3S97_06205)	-	1283548..1284171 (+)	624	WP_002446535.1	MBL fold metallo-hydrolase	-
O3S97_RS06205 (O3S97_06210)	comGA	1284227..1285201 (+)	975	WP_002446534.1	competence type IV pilus ATPase ComGA	Machinery gene
O3S97_RS06210 (O3S97_06215)	comGB	1285173..1286240 (+)	1068	WP_060545279.1	competence type IV pilus assembly protein ComGB	Machinery gene
O3S97_RS06215 (O3S97_06220)	comGC	1286258..1286575 (+)	318	WP_002446532.1	competence type IV pilus major pilin ComGC	Machinery gene
O3S97_RS06220 (O3S97_06225)	comGD	1286565..1287002 (+)	438	WP_060545280.1	competence type IV pilus minor pilin ComGD	-
O3S97_RS06225 (O3S97_06230)	-	1286989..1287282 (+)	294	WP_020367648.1	hypothetical protein	-
O3S97_RS06230 (O3S97_06235)	-	1287206..1287697 (+)	492	WP_060545281.1	competence type IV pilus minor pilin ComGF	-
O3S97_RS06235 (O3S97_06240)	-	1287862..1288374 (+)	513	WP_046044250.1	shikimate kinase	-
O3S97_RS06240 (O3S97_06245)	gcvT	1288592..1289683 (+)	1092	WP_060545282.1	glycine cleavage system aminomethyltransferase GcvT	-
O3S97_RS06245 (O3S97_06250)	gcvPA	1289703..1291049 (+)	1347	WP_002446526.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11491.53 Da
• Isoelectric Point: 9.2160

>NTDB_id=765993 O3S97_RS06215 WP_002446532.1 1286258..1286575(+) (comGC) [Staphylococcus epidermidis strain SE 4.8]
MKTLKLLKQTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRNPSNIDDLVSDG
FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=765993 O3S97_RS06215 WP_002446532.1 1286258..1286575(+) (comGC) [Staphylococcus epidermidis strain SE 4.8]
ATGAAAACATTGAAATTATTGAAACAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATCAGTTT
ATTATTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA
TGGTAAACAGTCAAATAGAAGCCTACGCTTTAAAACATAACCGCAACCCTTCTAATATTGATGATTTGGTTTCAGATGGT
TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAGGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	86.275	97.143	0.838
comGC	Staphylococcus aureus N315	86.275	97.143	0.838
comGC/cglC	Streptococcus mitis SK321	43.689	98.095	0.429
comGC/cglC	Streptococcus pneumoniae R6	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae TIGR4	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae Rx1	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae D39	43.617	89.524	0.39
comYC	Streptococcus mutans UA159	47.674	81.905	0.39
comYC	Streptococcus suis isolate S10	47.674	81.905	0.39
comYC	Streptococcus mutans UA140	47.674	81.905	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC/cglC	Streptococcus mitis NCTC 12261	50	72.381	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	78.095	0.362