Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   QM970_RS16060 Genome accession   NZ_CP125980
Coordinates   2994379..2994519 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain ZKY03     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2989379..2999519
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QM970_RS16035 (QM970_16045) - 2989403..2990590 (-) 1188 Protein_3091 sensor histidine kinase -
  QM970_RS16040 (QM970_16050) - 2990921..2992168 (-) 1248 WP_031600262.1 IS256-like element ISBsu2 family transposase -
  QM970_RS16045 (QM970_16055) - 2992241..2993092 (-) 852 WP_410490122.1 hypothetical protein -
  QM970_RS16050 (QM970_16060) comX 2993108..2993329 (-) 222 WP_014480704.1 competence pheromone ComX -
  QM970_RS16055 (QM970_16065) comQ 2993331..2994194 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  QM970_RS16060 (QM970_16070) degQ 2994379..2994519 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QM970_RS16065 (QM970_16075) - 2994741..2994866 (+) 126 WP_003228793.1 hypothetical protein -
  QM970_RS16070 (QM970_16080) - 2994981..2995349 (+) 369 WP_046381300.1 hypothetical protein -
  QM970_RS16075 (QM970_16085) pdeH 2995325..2996554 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  QM970_RS16080 (QM970_16090) pncB 2996691..2998163 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  QM970_RS16085 (QM970_16095) pncA 2998179..2998730 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  QM970_RS16090 (QM970_16100) yueI 2998827..2999225 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=765591 QM970_RS16060 WP_003220708.1 2994379..2994519(-) (degQ) [Bacillus subtilis strain ZKY03]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=765591 QM970_RS16060 WP_003220708.1 2994379..2994519(-) (degQ) [Bacillus subtilis strain ZKY03]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1