Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   QM974_RS00720 Genome accession   NZ_CP125966
Coordinates   153805..153930 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain H390r     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 148805..158930
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QM974_RS00695 (QM974_00695) - 148869..151091 (+) 2223 WP_271330814.1 ATP-dependent Clp protease ATP-binding subunit -
  QM974_RS00700 (QM974_00700) panD 151081..151437 (+) 357 WP_271330815.1 aspartate 1-decarboxylase -
  QM974_RS00705 (QM974_00705) - 151440..151733 (+) 294 WP_271330816.1 YbaB/EbfC family nucleoid-associated protein -
  QM974_RS00710 (QM974_00710) - 151733..152728 (+) 996 WP_271331139.1 PDZ domain-containing protein -
  QM974_RS00715 (QM974_00715) comB6 152734..153789 (+) 1056 WP_271330817.1 P-type conjugative transfer protein TrbL Machinery gene
  QM974_RS00720 (QM974_00720) comB7 153805..153930 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  QM974_RS00725 (QM974_00725) comB8 153927..154670 (+) 744 WP_000660533.1 virB8 family protein Machinery gene
  QM974_RS00730 (QM974_00730) comB9 154670..155632 (+) 963 WP_271330818.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QM974_RS00735 (QM974_00735) comB10 155625..156761 (+) 1137 WP_271330819.1 DNA type IV secretion system protein ComB10 Machinery gene
  QM974_RS00740 (QM974_00740) - 156831..158243 (+) 1413 WP_271330820.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=765438 QM974_RS00720 WP_001217874.1 153805..153930(+) (comB7) [Helicobacter pylori strain H390r]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=765438 QM974_RS00720 WP_001217874.1 153805..153930(+) (comB7) [Helicobacter pylori strain H390r]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878