Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   OZA25_RS10160 Genome accession   NZ_CP114038
Coordinates   1953738..1954004 (+) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain B8     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1948738..1959004
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OZA25_RS10140 (OZA25_10140) - 1949003..1950304 (-) 1302 WP_032874010.1 hemolysin family protein -
  OZA25_RS10145 (OZA25_10145) - 1950450..1951400 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  OZA25_RS10150 (OZA25_10150) comGA 1951597..1952667 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  OZA25_RS10155 (OZA25_10155) comGB 1952654..1953691 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  OZA25_RS10160 (OZA25_10160) comGC 1953738..1954004 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  OZA25_RS10165 (OZA25_10165) comGD 1953994..1954431 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  OZA25_RS10170 (OZA25_10170) comGE 1954415..1954729 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  OZA25_RS10175 (OZA25_10175) comGF 1954638..1955138 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  OZA25_RS10180 (OZA25_10180) comGG 1955139..1955516 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  OZA25_RS10185 (OZA25_10185) - 1955573..1955752 (+) 180 WP_022552966.1 YqzE family protein -
  OZA25_RS10190 (OZA25_10190) - 1955793..1956122 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  OZA25_RS10195 (OZA25_10195) tapA 1956381..1957052 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  OZA25_RS10200 (OZA25_10200) sipW 1957024..1957608 (+) 585 WP_032874025.1 signal peptidase I SipW -
  OZA25_RS10205 (OZA25_10205) tasA 1957673..1958458 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  OZA25_RS10210 (OZA25_10210) sinR 1958506..1958841 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=764185 OZA25_RS10160 WP_042635730.1 1953738..1954004(+) (comGC) [Bacillus velezensis strain B8]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=764185 OZA25_RS10160 WP_042635730.1 1953738..1954004(+) (comGC) [Bacillus velezensis strain B8]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602