Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   QLQ05_RS09260 Genome accession   NZ_CP125762
Coordinates   1741550..1741933 (+) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis strain KRS015     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1736550..1746933
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLQ05_RS09230 corA 1737003..1737956 (+) 954 WP_004399136.1 magnesium transporter CorA -
  QLQ05_RS09235 comGA 1738368..1739438 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QLQ05_RS09240 comGB 1739425..1740462 (+) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  QLQ05_RS09245 comGC 1740476..1740772 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QLQ05_RS09250 comGD 1740762..1741193 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  QLQ05_RS09255 comGE 1741177..1741524 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  QLQ05_RS09260 comGF 1741550..1741933 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  QLQ05_RS09265 comGG 1741934..1742308 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  QLQ05_RS09270 spoIIT 1742379..1742558 (+) 180 WP_003230176.1 YqzE family protein -
  QLQ05_RS09275 yqzG 1742600..1742926 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  QLQ05_RS09280 tapA 1743198..1743959 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  QLQ05_RS09285 sipW 1743943..1744515 (+) 573 WP_003246088.1 signal peptidase I SipW -
  QLQ05_RS09290 tasA 1744579..1745364 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  QLQ05_RS09295 sinR 1745457..1745792 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QLQ05_RS09300 sinI 1745826..1745999 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=763878 QLQ05_RS09260 WP_003230168.1 1741550..1741933(+) (comGF) [Bacillus subtilis strain KRS015]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=763878 QLQ05_RS09260 WP_003230168.1 1741550..1741933(+) (comGF) [Bacillus subtilis strain KRS015]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1