Detailed information    

insolico Bioinformatically predicted

Overview

Name   tfoS   Type   Regulator
Locus tag   OTJ99_RS11920 Genome accession   NZ_CP113864
Coordinates   2399748..2399840 (+) Length   30 a.a.
NCBI ID   WP_269015457.1    Uniprot ID   -
Organism   Caldicellulosiruptor naganoensis strain DSM 8991     
Function   chitin sensor (predicted from homology)   
Competence regulation

Genomic Context

Location: 2394748..2404840
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OTJ99_RS11895 (OTJ99_002380) - 2394835..2395575 (+) 741 WP_045166080.1 DUF72 domain-containing protein -
  OTJ99_RS11900 (OTJ99_002381) - 2395739..2397079 (-) 1341 WP_045166079.1 glycoside hydrolase family 30 beta sandwich domain-containing protein -
  OTJ99_RS11905 (OTJ99_002382) - 2397228..2397647 (-) 420 WP_235374919.1 amidohydrolase family protein -
  OTJ99_RS11910 (OTJ99_002383) - 2397743..2398261 (-) 519 WP_052671520.1 DUF3368 domain-containing protein -
  OTJ99_RS11915 (OTJ99_002384) - 2398245..2399366 (-) 1122 WP_045166078.1 helix-turn-helix domain-containing protein -
  OTJ99_RS11920 (OTJ99_002385) tfoS 2399748..2399840 (+) 93 WP_269015457.1 AraC family transcriptional regulator Regulator
  OTJ99_RS11925 (OTJ99_002386) nagA 2399848..2400990 (-) 1143 WP_045166077.1 N-acetylglucosamine-6-phosphate deacetylase -
  OTJ99_RS11930 (OTJ99_002387) - 2401017..2402660 (-) 1644 Protein_2314 beta-N-acetylhexosaminidase -
  OTJ99_RS11940 (OTJ99_002389) - 2402701..2403318 (-) 618 WP_235374913.1 hypothetical protein -
  OTJ99_RS11945 (OTJ99_002390) - 2403351..2403698 (-) 348 WP_045166076.1 substrate-binding domain-containing protein -
  OTJ99_RS11950 (OTJ99_002391) - 2403707..2403991 (-) 285 WP_045166075.1 GntR family transcriptional regulator -
  OTJ99_RS11955 (OTJ99_002392) - 2404613..2404771 (-) 159 WP_162182171.1 hypothetical protein -

Sequence

Protein


Download         Length: 30 a.a.        Molecular weight: 3534.04 Da        Isoelectric Point: 8.5805

>NTDB_id=763301 OTJ99_RS11920 WP_269015457.1 2399748..2399840(+) (tfoS) [Caldicellulosiruptor naganoensis strain DSM 8991]
MVGFSDEKYFSQVFKKYTGLTPSQFRESLL

Nucleotide


Download         Length: 93 bp        

>NTDB_id=763301 OTJ99_RS11920 WP_269015457.1 2399748..2399840(+) (tfoS) [Caldicellulosiruptor naganoensis strain DSM 8991]
ATGGTTGGCTTTTCTGATGAGAAGTATTTTTCTCAAGTTTTCAAAAAGTATACTGGACTTACACCAAGCCAGTTCAGGGA
GAGCCTGCTTTGA

Domains

Predicted by InterproScan.

Bacterial regulatory helix-turn-helix proteins, AraC family (HTH_AraC)

(1-26)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  tfoS Vibrio cholerae O1 biovar El Tor strain E7946

64

83.333

0.533