Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | OU809_RS16900 | Genome accession | NZ_CP113516 |
| Coordinates | 3361972..3362112 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | P69890 |
| Organism | Bacillus paralicheniformis strain 285-3 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3356972..3367112
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OU809_RS16875 (OU809_16875) | - | 3357265..3357654 (-) | 390 | WP_009329508.1 | hotdog fold thioesterase | - |
| OU809_RS16880 (OU809_16880) | comA | 3357671..3358309 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| OU809_RS16885 (OU809_16885) | comP | 3358396..3360711 (-) | 2316 | WP_020452789.1 | sensor histidine kinase | Regulator |
| OU809_RS16890 (OU809_16890) | comX | 3360732..3360902 (-) | 171 | WP_020452790.1 | competence pheromone ComX | - |
| OU809_RS16895 (OU809_16895) | - | 3360874..3361785 (-) | 912 | WP_020452791.1 | polyprenyl synthetase family protein | - |
| OU809_RS16900 (OU809_16900) | degQ | 3361972..3362112 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| OU809_RS16905 (OU809_16905) | - | 3362598..3362945 (+) | 348 | WP_223254849.1 | hypothetical protein | - |
| OU809_RS16910 (OU809_16910) | - | 3362988..3364208 (-) | 1221 | WP_020452793.1 | EAL and HDOD domain-containing protein | - |
| OU809_RS16915 (OU809_16915) | - | 3364386..3365855 (-) | 1470 | WP_023856157.1 | nicotinate phosphoribosyltransferase | - |
| OU809_RS16920 (OU809_16920) | - | 3365873..3366424 (-) | 552 | WP_020452795.1 | cysteine hydrolase family protein | - |
| OU809_RS16925 (OU809_16925) | - | 3366610..3367011 (-) | 402 | WP_025809741.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=762625 OU809_RS16900 WP_003184860.1 3361972..3362112(-) (degQ) [Bacillus paralicheniformis strain 285-3]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=762625 OU809_RS16900 WP_003184860.1 3361972..3362112(-) (degQ) [Bacillus paralicheniformis strain 285-3]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |