Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   OHP008_RS00755 Genome accession   NZ_AP024965
Coordinates   173427..173540 (-) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   -
Organism   Helicobacter pylori strain #8     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 168427..178540
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OHP008_RS00735 (OHP008_01490) - 169120..170532 (-) 1413 WP_223888426.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  OHP008_RS00740 (OHP008_01500) comB10 170602..171732 (-) 1131 WP_223888427.1 DNA type IV secretion system protein ComB10 Machinery gene
  OHP008_RS00745 (OHP008_01510) comB9 171725..172687 (-) 963 WP_223888428.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  OHP008_RS00750 (OHP008_01520) comB8 172687..173430 (-) 744 WP_000660524.1 virB8 family protein Machinery gene
  OHP008_RS00755 comB7 173427..173540 (-) 114 WP_001217868.1 hypothetical protein Machinery gene
  OHP008_RS00760 (OHP008_01530) comB6 173556..174611 (-) 1056 WP_223888429.1 P-type conjugative transfer protein TrbL Machinery gene
  OHP008_RS00765 (OHP008_01540) - 174617..175612 (-) 996 WP_223888752.1 PDZ domain-containing protein -
  OHP008_RS00770 (OHP008_01550) - 175612..175905 (-) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  OHP008_RS00775 (OHP008_01560) panD 175908..176261 (-) 354 WP_000142245.1 aspartate 1-decarboxylase -
  OHP008_RS00780 (OHP008_01570) - 176251..178473 (-) 2223 WP_223888430.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=76252 OHP008_RS00755 WP_001217868.1 173427..173540(-) (comB7) [Helicobacter pylori strain #8]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=76252 OHP008_RS00755 WP_001217868.1 173427..173540(-) (comB7) [Helicobacter pylori strain #8]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919


Multiple sequence alignment