Detailed information    

insolico Bioinformatically predicted

Overview

Name   rcrR   Type   Regulator
Locus tag   OQG81_RS06840 Genome accession   NZ_CP113440
Coordinates   1284846..1285286 (-) Length   146 a.a.
NCBI ID   WP_093529491.1    Uniprot ID   A0A1C3SQK7
Organism   Streptococcus macedonicus strain E37     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1277261..1301001 1284846..1285286 within 0


Gene organization within MGE regions


Location: 1277261..1301001
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OQG81_RS06805 (OQG81_06805) - 1277261..1278034 (-) 774 WP_099412050.1 ABC transporter ATP-binding protein -
  OQG81_RS06810 (OQG81_06810) - 1278047..1278967 (-) 921 WP_099412049.1 glycine betaine ABC transporter substrate-binding protein -
  OQG81_RS06815 (OQG81_06815) - 1278957..1279592 (-) 636 WP_058621581.1 ABC transporter permease -
  OQG81_RS06820 (OQG81_06820) - 1279582..1280034 (-) 453 WP_058621580.1 MarR family winged helix-turn-helix transcriptional regulator -
  OQG81_RS06825 (OQG81_06825) - 1280024..1281000 (-) 977 Protein_1285 zinc-binding dehydrogenase -
  OQG81_RS06830 (OQG81_06830) rcrQ 1281266..1283038 (-) 1773 WP_093528514.1 ABC transporter ATP-binding protein Regulator
  OQG81_RS06835 (OQG81_06835) rcrP 1283028..1284842 (-) 1815 WP_058621579.1 ABC transporter ATP-binding protein Regulator
  OQG81_RS06840 (OQG81_06840) rcrR 1284846..1285286 (-) 441 WP_093529491.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  OQG81_RS06845 (OQG81_06845) - 1285462..1285872 (-) 411 WP_014294719.1 peptide deformylase -
  OQG81_RS06850 (OQG81_06850) - 1285947..1286378 (-) 432 WP_014294720.1 GNAT family N-acetyltransferase -
  OQG81_RS06855 (OQG81_06855) gdhA 1286656..1288008 (-) 1353 WP_014294721.1 NADP-specific glutamate dehydrogenase -
  OQG81_RS06860 (OQG81_06860) - 1288439..1288936 (+) 498 WP_093528520.1 DUF308 domain-containing protein -
  OQG81_RS06865 (OQG81_06865) queF 1288991..1289482 (-) 492 WP_180384466.1 preQ(1) synthase -
  OQG81_RS06870 (OQG81_06870) queE 1289495..1290208 (-) 714 WP_409374428.1 7-carboxy-7-deazaguanine synthase QueE -
  OQG81_RS06875 (OQG81_06875) queD 1290201..1290647 (-) 447 WP_014294725.1 6-carboxytetrahydropterin synthase QueD -
  OQG81_RS06880 (OQG81_06880) queC 1290640..1291299 (-) 660 WP_014294726.1 7-cyano-7-deazaguanine synthase QueC -
  OQG81_RS06885 (OQG81_06885) - 1291544..1293310 (-) 1767 WP_265643763.1 ABC transporter ATP-binding protein -
  OQG81_RS06890 (OQG81_06890) - 1293313..1295052 (-) 1740 WP_265643764.1 ABC transporter ATP-binding protein -
  OQG81_RS06895 (OQG81_06895) - 1295130..1297001 (-) 1872 WP_099412043.1 ABC-F family ATP-binding cassette domain-containing protein -
  OQG81_RS06900 (OQG81_06900) - 1296998..1298203 (-) 1206 WP_039670892.1 CCA tRNA nucleotidyltransferase -
  OQG81_RS06905 (OQG81_06905) dapB 1298200..1298967 (-) 768 WP_099412042.1 4-hydroxy-tetrahydrodipicolinate reductase -
  OQG81_RS06910 (OQG81_06910) - 1298987..1299835 (-) 849 WP_039670893.1 DegV family protein -
  OQG81_RS06915 (OQG81_06915) - 1299835..1300215 (-) 381 WP_039670894.1 DUF1149 family protein -

Sequence

Protein


Download         Length: 146 a.a.        Molecular weight: 17145.64 Da        Isoelectric Point: 9.6229

>NTDB_id=762301 OQG81_RS06840 WP_093529491.1 1284846..1285286(-) (rcrR) [Streptococcus macedonicus strain E37]
MHKKDPFSQFRDFINLMENRVHALAESYGVENLAGPQGFAVLYLRDNPDKEIYIKDIEKRLRISKSVTSNLIKRMEKNGF
IQVVSSKEDKRYKQVVLTELGKSKAQNIQDFHDEIHRQILAGVDHEDLKISFRVFDRILKNLENKE

Nucleotide


Download         Length: 441 bp        

>NTDB_id=762301 OQG81_RS06840 WP_093529491.1 1284846..1285286(-) (rcrR) [Streptococcus macedonicus strain E37]
ATGCACAAGAAAGATCCGTTTTCACAGTTTAGGGATTTTATCAATTTAATGGAAAATCGTGTCCATGCCCTTGCGGAAAG
TTATGGTGTTGAAAATCTGGCTGGCCCACAGGGATTTGCGGTATTGTATCTTCGTGATAATCCCGATAAAGAAATTTATA
TCAAGGACATTGAGAAGAGACTAAGAATTTCAAAGTCAGTGACTAGTAATTTGATTAAGCGCATGGAGAAAAATGGTTTT
ATCCAAGTTGTTTCGTCGAAAGAAGATAAGCGTTATAAGCAAGTGGTGTTGACTGAACTTGGAAAATCAAAGGCTCAGAA
TATTCAAGATTTCCATGATGAAATTCATAGGCAAATCTTAGCTGGTGTTGACCATGAGGATCTCAAAATCTCGTTTCGCG
TCTTTGACCGCATTTTGAAAAATTTAGAAAACAAGGAGTAA

Domains

Predicted by InterproScan.

MarR family (MarR_2)

(35-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1C3SQK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

55.245

97.945

0.541