Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   OTB22_RS08005 Genome accession   NZ_CP113267
Coordinates   1580794..1580943 (-) Length   49 a.a.
NCBI ID   WP_001820573.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain BC2     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 1576581..1582199 1580794..1580943 within 0


Gene organization within MGE regions


Location: 1576581..1582199
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OTB22_RS07975 (OTB22_07980) - 1576581..1577534 (+) 954 WP_001155321.1 IS30-like element ISSpn8 family transposase -
  OTB22_RS07980 (OTB22_07985) - 1577624..1578235 (-) 612 WP_000394049.1 CPBP family intramembrane glutamic endopeptidase -
  OTB22_RS07985 (OTB22_07990) blpZ 1578386..1578619 (-) 234 WP_001818347.1 immunity protein BlpZ -
  OTB22_RS07990 (OTB22_07995) - 1578661..1579350 (-) 690 WP_000760510.1 CPBP family intramembrane glutamic endopeptidase -
  OTB22_RS07995 (OTB22_08000) - 1579402..1579785 (-) 384 WP_000877381.1 hypothetical protein -
  OTB22_RS08000 (OTB22_08005) - 1580571..1580690 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  OTB22_RS08005 (OTB22_08010) cipB 1580794..1580943 (-) 150 WP_001820573.1 bacteriocin-like peptide BlpO Regulator
  OTB22_RS08010 (OTB22_08015) blpN 1581187..1581390 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  OTB22_RS08015 (OTB22_08020) blpM 1581406..1581660 (-) 255 WP_000379877.1 two-peptide bacteriocin subunit BlpM -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5150.91 Da        Isoelectric Point: 3.9133

>NTDB_id=761486 OTB22_RS08005 WP_001820573.1 1580794..1580943(-) (cipB) [Streptococcus pneumoniae strain BC2]
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=761486 OTB22_RS08005 WP_001820573.1 1580794..1580943(-) (cipB) [Streptococcus pneumoniae strain BC2]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51