Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   OS912_RS08915 Genome accession   NZ_CP113266
Coordinates   1746569..1746718 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain BC1     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1741569..1751718
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OS912_RS08890 (OS912_08895) blpC 1741840..1741995 (-) 156 WP_000358811.1 quorum-sensing system pheromone BlpC -
  OS912_RS08895 (OS912_08900) - 1742052..1743413 (-) 1362 WP_268232904.1 bacteriocin secretion accessory protein -
  OS912_RS08900 (OS912_08905) blpA 1743424..1745577 (-) 2154 Protein_1718 peptide cleavage/export ABC transporter BlpA -
  OS912_RS08905 (OS912_08910) blpM 1745852..1746106 (+) 255 WP_001093255.1 two-peptide bacteriocin subunit BlpM -
  OS912_RS08910 (OS912_08915) blpN 1746122..1746325 (+) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  OS912_RS08915 (OS912_08920) cipB 1746569..1746718 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  OS912_RS08920 (OS912_08925) - 1746822..1746941 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  OS912_RS08925 (OS912_08930) - 1747400..1747784 (+) 385 Protein_1723 immunity protein -
  OS912_RS08930 (OS912_08935) - 1748413..1748796 (+) 384 WP_000877381.1 hypothetical protein -
  OS912_RS08935 (OS912_08940) - 1748848..1749537 (+) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  OS912_RS08940 (OS912_08945) blpZ 1749579..1749812 (+) 234 WP_000276498.1 immunity protein BlpZ -
  OS912_RS08945 (OS912_08950) - 1749963..1750574 (+) 612 WP_000394044.1 CPBP family intramembrane glutamic endopeptidase -
  OS912_RS08950 (OS912_08955) ccrZ 1750735..1751529 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=761444 OS912_RS08915 WP_001809846.1 1746569..1746718(+) (cipB) [Streptococcus pneumoniae strain BC1]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=761444 OS912_RS08915 WP_001809846.1 1746569..1746718(+) (cipB) [Streptococcus pneumoniae strain BC1]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531