Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | ORP33_RS12835 | Genome accession | NZ_CP113256 |
| Coordinates | 2498191..2498601 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain K1 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2491294..2547562 | 2498191..2498601 | within | 0 |
Gene organization within MGE regions
Location: 2491294..2547562
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORP33_RS12795 (ORP33_12550) | yqeH | 2491294..2492394 (-) | 1101 | WP_003229966.1 | ribosome biogenesis GTPase YqeH | - |
| ORP33_RS12800 (ORP33_12555) | yqeG | 2492398..2492916 (-) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| ORP33_RS12805 (ORP33_12560) | - | 2493278..2493418 (+) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| ORP33_RS12810 (ORP33_12565) | yqeF | 2493724..2494455 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| ORP33_RS12815 (ORP33_12570) | cwlH | 2494707..2495459 (-) | 753 | WP_087961324.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| ORP33_RS12820 (ORP33_12575) | yqeD | 2495646..2496272 (+) | 627 | WP_038427798.1 | TVP38/TMEM64 family protein | - |
| ORP33_RS12825 (ORP33_12580) | gnd | 2496291..2497184 (-) | 894 | WP_043857850.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| ORP33_RS12830 (ORP33_12585) | yqeB | 2497436..2498158 (+) | 723 | WP_010886572.1 | hypothetical protein | - |
| ORP33_RS12835 (ORP33_12590) | nucA/comI | 2498191..2498601 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| ORP33_RS12840 (ORP33_12595) | - | 2498797..2499147 (+) | 351 | Protein_2480 | sigma-70 family RNA polymerase sigma factor | - |
| ORP33_RS12845 (ORP33_12600) | spoIVCA | 2499175..2500635 (-) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| ORP33_RS12850 | - | 2500593..2500771 (-) | 179 | Protein_2482 | hypothetical protein | - |
| ORP33_RS12855 (ORP33_12605) | arsC | 2501126..2501545 (-) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| ORP33_RS12860 (ORP33_12610) | acr3 | 2501557..2502597 (-) | 1041 | WP_032722149.1 | arsenite efflux transporter Acr3 | - |
| ORP33_RS12865 (ORP33_12615) | arsK | 2502620..2503060 (-) | 441 | WP_032722151.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| ORP33_RS12870 (ORP33_12620) | arsR | 2503119..2503436 (-) | 318 | WP_029318103.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| ORP33_RS12875 (ORP33_12625) | yqcI | 2503808..2504572 (-) | 765 | WP_017696291.1 | YqcI/YcgG family protein | - |
| ORP33_RS12880 (ORP33_12630) | rapE | 2505015..2506142 (+) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| ORP33_RS12885 (ORP33_12635) | phrE | 2506132..2506266 (+) | 135 | WP_004398770.1 | phosphatase RapE inhibitor PhrE | - |
| ORP33_RS12890 (ORP33_12640) | - | 2506376..2506534 (+) | 159 | WP_003245945.1 | hypothetical protein | - |
| ORP33_RS21095 | - | 2506498..2506788 (+) | 291 | WP_418910793.1 | hypothetical protein | - |
| ORP33_RS12895 (ORP33_12645) | yqcG | 2506904..2508499 (+) | 1596 | WP_004399034.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| ORP33_RS12900 (ORP33_12650) | yqcF | 2508514..2509092 (+) | 579 | WP_009967790.1 | type VII secretion system immunity protein YqcF | - |
| ORP33_RS12905 (ORP33_12655) | - | 2509210..2509356 (+) | 147 | WP_009967791.1 | hypothetical protein | - |
| ORP33_RS12910 (ORP33_12660) | - | 2509353..2509715 (-) | 363 | WP_003229947.1 | hypothetical protein | - |
| ORP33_RS12915 (ORP33_12665) | - | 2509731..2510210 (-) | 480 | WP_004399085.1 | hypothetical protein | - |
| ORP33_RS12920 (ORP33_12670) | cwlA | 2510375..2511193 (-) | 819 | WP_017697459.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| ORP33_RS12925 (ORP33_12675) | skhD | 2511238..2511660 (-) | 423 | WP_017697460.1 | phage holin family protein | - |
| ORP33_RS12930 (ORP33_12680) | xepA | 2511706..2512599 (-) | 894 | WP_032722160.1 | phage-like element PBSX protein XepA | - |
| ORP33_RS12935 (ORP33_12685) | yqcE | 2512687..2512851 (-) | 165 | WP_003229944.1 | XkdX family protein | - |
| ORP33_RS12940 (ORP33_12690) | yqcD | 2512848..2513183 (-) | 336 | WP_009967793.1 | XkdW family protein | - |
| ORP33_RS12945 (ORP33_12695) | yqcC | 2513193..2514293 (-) | 1101 | WP_032722161.1 | pyocin knob domain-containing protein | - |
| ORP33_RS12950 (ORP33_12700) | - | 2514297..2514569 (-) | 273 | WP_032722163.1 | hypothetical protein | - |
| ORP33_RS12955 (ORP33_12705) | yqcA | 2514566..2515144 (-) | 579 | WP_032722164.1 | YmfQ family protein | - |
| ORP33_RS12960 (ORP33_12710) | yqbT | 2515128..2516174 (-) | 1047 | WP_032722165.1 | baseplate J/gp47 family protein | - |
| ORP33_RS12965 (ORP33_12715) | yqbS | 2516167..2516592 (-) | 426 | WP_032722166.1 | DUF2634 domain-containing protein | - |
| ORP33_RS12970 (ORP33_12720) | yqbR | 2516605..2516871 (-) | 267 | WP_032722167.1 | DUF2577 family protein | - |
| ORP33_RS12975 (ORP33_12725) | yqbQ | 2516868..2517848 (-) | 981 | WP_032722168.1 | XkdQ/YqbQ family protein | - |
| ORP33_RS12980 (ORP33_12730) | yqbP | 2517861..2518520 (-) | 660 | WP_032722169.1 | LysM peptidoglycan-binding domain-containing protein | - |
| ORP33_RS12985 (ORP33_12735) | yqbO | 2518513..2523270 (-) | 4758 | WP_267932958.1 | phage tail tape measure protein | - |
| ORP33_RS12990 | - | 2523273..2523410 (-) | 138 | WP_021480099.1 | hypothetical protein | - |
| ORP33_RS12995 (ORP33_12740) | - | 2523452..2523901 (-) | 450 | WP_032722171.1 | phage tail assembly chaperone | - |
| ORP33_RS13000 (ORP33_12745) | txpA | 2524047..2524226 (+) | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | - |
| ORP33_RS13005 (ORP33_12750) | bsrH | 2524606..2524695 (+) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| ORP33_RS13010 (ORP33_12755) | yqbM | 2524949..2525392 (-) | 444 | WP_003229930.1 | phage tail tube protein | - |
| ORP33_RS13015 (ORP33_12760) | yqbK | 2525395..2526795 (-) | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| ORP33_RS13020 | - | 2526796..2526987 (-) | 192 | WP_010886574.1 | hypothetical protein | - |
| ORP33_RS13025 (ORP33_12765) | yqbJ | 2526984..2527421 (-) | 438 | WP_003229927.1 | phage tail terminator family protein | - |
| ORP33_RS13030 (ORP33_12770) | yqbI | 2527434..2527937 (-) | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| ORP33_RS13035 (ORP33_12775) | yqbH | 2527934..2528296 (-) | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| ORP33_RS13040 (ORP33_12780) | gkpG | 2528293..2528688 (-) | 396 | WP_004398566.1 | DUF3199 family protein | - |
| ORP33_RS13045 (ORP33_12785) | yqbF | 2528692..2529003 (-) | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| ORP33_RS13050 (ORP33_12790) | skdG | 2529014..2529949 (-) | 936 | WP_003229922.1 | phage major capsid protein | - |
| ORP33_RS13055 (ORP33_12795) | yqbD | 2529968..2530937 (-) | 970 | Protein_2524 | XkdF-like putative serine protease domain-containing protein | - |
| ORP33_RS13060 (ORP33_12800) | - | 2530970..2531623 (-) | 654 | WP_003229920.1 | hypothetical protein | - |
| ORP33_RS13065 (ORP33_12805) | yqbB | 2531664..2532581 (-) | 918 | WP_004398748.1 | phage head morphogenesis protein | - |
| ORP33_RS13070 (ORP33_12810) | yqbA | 2532578..2534110 (-) | 1533 | WP_004398894.1 | phage portal protein | - |
| ORP33_RS13075 (ORP33_12815) | stmB | 2534114..2535409 (-) | 1296 | WP_003229917.1 | PBSX family phage terminase large subunit | - |
| ORP33_RS13080 (ORP33_12820) | terS | 2535402..2536121 (-) | 720 | WP_003229916.1 | phage terminase small subunit | - |
| ORP33_RS13085 (ORP33_12825) | - | 2536189..2536653 (-) | 465 | WP_004398685.1 | hypothetical protein | - |
| ORP33_RS13090 (ORP33_12830) | yqaQ | 2536797..2537252 (-) | 456 | WP_004398775.1 | hypothetical protein | - |
| ORP33_RS13095 (ORP33_12835) | - | 2537450..2538379 (+) | 930 | WP_003229913.1 | hypothetical protein | - |
| ORP33_RS13100 (ORP33_12840) | yqaO | 2538453..2538659 (-) | 207 | WP_003229912.1 | XtrA/YqaO family protein | - |
| ORP33_RS13105 (ORP33_12845) | yqaN | 2538741..2539169 (-) | 429 | WP_009967809.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ORP33_RS13110 (ORP33_12850) | - | 2539265..2539414 (-) | 150 | WP_003229910.1 | hypothetical protein | - |
| ORP33_RS13115 (ORP33_12855) | sknM | 2539405..2540346 (-) | 942 | WP_075058863.1 | ATP-binding protein | - |
| ORP33_RS13120 (ORP33_12860) | yqaL | 2540228..2540905 (-) | 678 | WP_116362964.1 | DnaD domain-containing protein | - |
| ORP33_RS13125 (ORP33_12865) | recT | 2540981..2541835 (-) | 855 | WP_003229907.1 | recombinase RecT | - |
| ORP33_RS13130 (ORP33_12870) | yqaJ | 2541838..2542797 (-) | 960 | WP_004398673.1 | YqaJ viral recombinase family protein | - |
| ORP33_RS13135 (ORP33_12875) | yqaI | 2542903..2543097 (-) | 195 | WP_003229905.1 | YqaI family protein | - |
| ORP33_RS13140 | - | 2543057..2543230 (-) | 174 | WP_119123069.1 | hypothetical protein | - |
| ORP33_RS13145 (ORP33_12880) | sknH | 2543227..2543484 (-) | 258 | WP_003245994.1 | YqaH family protein | - |
| ORP33_RS13150 (ORP33_12885) | yqaG | 2543481..2544050 (-) | 570 | WP_004398626.1 | helix-turn-helix domain-containing protein | - |
| ORP33_RS13155 (ORP33_12890) | - | 2544124..2544264 (-) | 141 | WP_003229902.1 | hypothetical protein | - |
| ORP33_RS13160 (ORP33_12895) | yqaF | 2544294..2544524 (-) | 231 | WP_004398958.1 | helix-turn-helix transcriptional regulator | - |
| ORP33_RS13165 (ORP33_12900) | sknR | 2544701..2545051 (+) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
| ORP33_RS13170 (ORP33_12905) | - | 2545318..2545485 (-) | 168 | WP_003229900.1 | hypothetical protein | - |
| ORP33_RS13175 (ORP33_12910) | yqaC | 2545841..2546377 (-) | 537 | WP_004399117.1 | AAA family ATPase | - |
| ORP33_RS13180 (ORP33_12915) | yqaB | 2546646..2547164 (+) | 519 | WP_015714342.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ORP33_RS13185 (ORP33_12920) | - | 2547164..2547562 (+) | 399 | Protein_2550 | sigma-70 family RNA polymerase sigma factor | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=761272 ORP33_RS12835 WP_009967785.1 2498191..2498601(-) (nucA/comI) [Bacillus subtilis strain K1]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=761272 ORP33_RS12835 WP_009967785.1 2498191..2498601(-) (nucA/comI) [Bacillus subtilis strain K1]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTACCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTACCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |