NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	OS082_RS08735	Genome accession	NZ_CP113007
Coordinates	1692319..1692630 (+)	Length	103 a.a.
NCBI ID	WP_000472256.1	Uniprot ID	-
Organism	Staphylococcus aureus strain Ryze
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1687319..1697630

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OS082_RS08705	-	1688102..1688305 (+)	204	WP_000087561.1	YqgQ family protein	-
OS082_RS08710	-	1688302..1689288 (+)	987	WP_000161314.1	ROK family glucokinase	-
OS082_RS08715	-	1689288..1689617 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
OS082_RS08720	-	1689614..1690237 (+)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
OS082_RS08725	comGA	1690289..1691263 (+)	975	WP_000697228.1	competence type IV pilus ATPase ComGA	Machinery gene
OS082_RS08730	comGB	1691235..1692305 (+)	1071	WP_000775706.1	competence type IV pilus assembly protein ComGB	Machinery gene
OS082_RS08735	comGC	1692319..1692630 (+)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
OS082_RS08740	comGD	1692608..1693054 (+)	447	WP_001790850.1	competence type IV pilus minor pilin ComGD	Machinery gene
OS082_RS08745	comGE	1693041..1693340 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
OS082_RS08750	comGF	1693258..1693755 (+)	498	WP_001803317.1	competence type IV pilus minor pilin ComGF	Machinery gene
OS082_RS08755	-	1693852..1693998 (+)	147	WP_001789879.1	hypothetical protein	-
OS082_RS08760	-	1693988..1694512 (+)	525	WP_001015117.1	shikimate kinase	-
OS082_RS08765	gcvT	1694671..1695762 (+)	1092	WP_000093351.1	glycine cleavage system aminomethyltransferase GcvT	-
OS082_RS08770	gcvPA	1695782..1697128 (+)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268

                                >NTDB_id=758981 OS082_RS08735 WP_000472256.1 1692319..1692630(+) (comGC) [Staphylococcus aureus strain Ryze]

MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI

KEAQKTCKSGETITISNGEAVAN

Nucleotide

Download Length: 312 bp

                                >NTDB_id=758981 OS082_RS08735 WP_000472256.1 1692319..1692630(+) (comGC) [Staphylococcus aureus strain Ryze]

ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT

AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA

ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA

AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(6-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369

Detailed information NTG0758981