Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   OP701_RS12660 Genome accession   NZ_CP111073
Coordinates   2529946..2530329 (-) Length   127 a.a.
NCBI ID   WP_060399016.1    Uniprot ID   -
Organism   Bacillus inaquosorum strain BSXE-2102     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2524946..2535329
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OP701_RS12620 (OP701_12620) sinI 2525874..2526047 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  OP701_RS12625 (OP701_12625) sinR 2526081..2526416 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  OP701_RS12630 (OP701_12630) tasA 2526511..2527296 (-) 786 WP_003236939.1 biofilm matrix protein TasA -
  OP701_RS12635 (OP701_12635) sipW 2527360..2527932 (-) 573 WP_080429111.1 signal peptidase I SipW -
  OP701_RS12640 (OP701_12640) tapA 2527916..2528680 (-) 765 WP_060399014.1 amyloid fiber anchoring/assembly protein TapA -
  OP701_RS12645 (OP701_12645) - 2528953..2529279 (+) 327 WP_029316858.1 YqzG/YhdC family protein -
  OP701_RS12650 (OP701_12650) - 2529321..2529500 (-) 180 WP_003236949.1 YqzE family protein -
  OP701_RS12655 (OP701_12655) comGG 2529571..2529945 (-) 375 WP_060399015.1 competence type IV pilus minor pilin ComGG Machinery gene
  OP701_RS12660 (OP701_12660) comGF 2529946..2530329 (-) 384 WP_060399016.1 competence type IV pilus minor pilin ComGF Machinery gene
  OP701_RS12665 (OP701_12665) comGE 2530355..2530699 (-) 345 WP_060399017.1 competence type IV pilus minor pilin ComGE Machinery gene
  OP701_RS12670 (OP701_12670) comGD 2530683..2531114 (-) 432 WP_060399018.1 competence type IV pilus minor pilin ComGD Machinery gene
  OP701_RS12675 (OP701_12675) comGC 2531104..2531400 (-) 297 WP_003236957.1 comG operon protein ComGC Machinery gene
  OP701_RS12680 (OP701_12680) comGB 2531414..2532451 (-) 1038 WP_060399019.1 competence type IV pilus assembly protein ComGB Machinery gene
  OP701_RS12685 (OP701_12685) comGA 2532438..2533508 (-) 1071 WP_060399020.1 competence protein ComGA Machinery gene
  OP701_RS12690 (OP701_12690) - 2533471..2533746 (-) 276 WP_060399021.1 hypothetical protein -
  OP701_RS12695 (OP701_12695) - 2533724..2534134 (-) 411 WP_060399022.1 CBS domain-containing protein -
  OP701_RS12700 (OP701_12700) corA 2534197..2535141 (-) 945 WP_003236968.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 127 a.a.        Molecular weight: 14472.80 Da        Isoelectric Point: 7.9434

>NTDB_id=757665 OP701_RS12660 WP_060399016.1 2529946..2530329(-) (comGF) [Bacillus inaquosorum strain BSXE-2102]
MLISGSLAMIFHLFLSRQQEHDGFTQQEWMISTEQMMNECKKSQIVKIAEHGRVLICTNLSGQDIRFETYHSMIRKRVDG
KGHVPILYHITAMKADIENGIVLLNIKSKDEKVYQTAFPVYTSLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=757665 OP701_RS12660 WP_060399016.1 2529946..2530329(-) (comGF) [Bacillus inaquosorum strain BSXE-2102]
TTGCTCATATCAGGATCGTTAGCTATGATCTTCCATCTGTTTTTGTCACGACAGCAGGAGCATGACGGTTTCACACAGCA
AGAATGGATGATTTCAACGGAGCAGATGATGAACGAGTGCAAGAAGTCTCAAATAGTCAAGATAGCCGAGCATGGGAGAG
TATTGATCTGCACCAATCTTTCCGGGCAAGACATCCGTTTTGAAACCTATCATTCAATGATCAGAAAAAGGGTGGATGGC
AAAGGGCATGTGCCGATTCTCTATCATATTACTGCCATGAAAGCTGATATTGAAAATGGGATTGTGTTGTTAAATATTAA
GAGCAAGGATGAAAAAGTGTATCAAACTGCTTTTCCGGTTTATACGTCTTTAGGAGGAGGATGA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(16-114)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

86.614

100

0.866