Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   OGV27_RS14745 Genome accession   NZ_CP110847
Coordinates   2998366..2998506 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SGTSH 0811     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2993366..3003506
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OGV27_RS14720 (OGV27_14720) - 2993712..2994095 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  OGV27_RS14725 (OGV27_14725) comA 2994117..2994761 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  OGV27_RS14730 (OGV27_14730) comP 2994842..2997142 (-) 2301 WP_032876801.1 histidine kinase Regulator
  OGV27_RS14735 (OGV27_14735) comX 2997156..2997329 (-) 174 WP_012118314.1 competence pheromone ComX -
  OGV27_RS14740 (OGV27_14740) - 2997298..2998158 (-) 861 WP_142925231.1 polyprenyl synthetase family protein -
  OGV27_RS14745 (OGV27_14745) degQ 2998366..2998506 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  OGV27_RS14750 (OGV27_14750) - 2998972..2999313 (+) 342 WP_032876795.1 hypothetical protein -
  OGV27_RS14755 (OGV27_14755) - 2999320..3000543 (-) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  OGV27_RS14760 (OGV27_14760) - 3000673..3002139 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  OGV27_RS14765 (OGV27_14765) - 3002157..3002708 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  OGV27_RS14770 (OGV27_14770) - 3002805..3003203 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=756568 OGV27_RS14745 WP_003152043.1 2998366..2998506(-) (degQ) [Bacillus velezensis strain SGTSH 0811]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=756568 OGV27_RS14745 WP_003152043.1 2998366..2998506(-) (degQ) [Bacillus velezensis strain SGTSH 0811]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891