Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   OPU65_RS00760 Genome accession   NZ_CP110812
Coordinates   126135..126311 (-) Length   58 a.a.
NCBI ID   WP_243943156.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain CamBx3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 121135..131311
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OPU65_RS00715 (OPU65_00715) comGE 121466..121813 (+) 348 WP_243943148.1 competence type IV pilus minor pilin ComGE -
  OPU65_RS00720 (OPU65_00720) comGF 121746..122210 (+) 465 WP_265626335.1 competence type IV pilus minor pilin ComGF -
  OPU65_RS00725 (OPU65_00725) comGG 122222..122587 (+) 366 WP_265626336.1 competence type IV pilus minor pilin ComGG -
  OPU65_RS00730 (OPU65_00730) - 122676..122858 (+) 183 WP_020452171.1 YqzE family protein -
  OPU65_RS00735 (OPU65_00735) - 122887..123207 (-) 321 WP_165427557.1 YqzG/YhdC family protein -
  OPU65_RS00740 (OPU65_00740) tapA 123485..124213 (+) 729 WP_265626339.1 amyloid fiber anchoring/assembly protein TapA -
  OPU65_RS00745 (OPU65_00745) sipW 124210..124794 (+) 585 WP_075752363.1 signal peptidase I SipW -
  OPU65_RS00750 (OPU65_00750) tasA 124867..125661 (+) 795 WP_265626340.1 biofilm matrix protein TasA -
  OPU65_RS00755 (OPU65_00755) sinR 125766..126101 (-) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  OPU65_RS00760 (OPU65_00760) sinI 126135..126311 (-) 177 WP_243943156.1 anti-repressor SinI Regulator
  OPU65_RS00765 (OPU65_00765) - 126502..127296 (-) 795 WP_265626343.1 YqhG family protein -
  OPU65_RS00770 (OPU65_00770) - 127303..128982 (-) 1680 WP_265626344.1 DEAD/DEAH box helicase -
  OPU65_RS00775 (OPU65_00775) gcvT 129577..130671 (+) 1095 WP_265626345.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6766.56 Da        Isoelectric Point: 4.7906

>NTDB_id=756338 OPU65_RS00760 WP_243943156.1 126135..126311(-) (sinI) [Bacillus paralicheniformis strain CamBx3]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLDKKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=756338 OPU65_RS00760 WP_243943156.1 126135..126311(-) (sinI) [Bacillus paralicheniformis strain CamBx3]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGATAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517