Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | LFL98_RS13035 | Genome accession | NZ_CP110365 |
| Coordinates | 2511647..2512057 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain HY2-62 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2504750..2532039 | 2511647..2512057 | within | 0 |
Gene organization within MGE regions
Location: 2504750..2532039
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LFL98_RS12995 (LFL98_13000) | yqeH | 2504750..2505850 (-) | 1101 | WP_003229966.1 | ribosome biogenesis GTPase YqeH | - |
| LFL98_RS13000 (LFL98_13005) | yqeG | 2505854..2506372 (-) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| LFL98_RS13005 (LFL98_13010) | - | 2506734..2506874 (+) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| LFL98_RS13010 (LFL98_13015) | yqeF | 2507180..2507911 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| LFL98_RS13015 (LFL98_13020) | cwlH | 2508163..2508915 (-) | 753 | WP_080529562.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| LFL98_RS13020 (LFL98_13025) | yqeD | 2509102..2509728 (+) | 627 | WP_213420161.1 | TVP38/TMEM64 family protein | - |
| LFL98_RS13025 (LFL98_13030) | gnd | 2509747..2510640 (-) | 894 | WP_015714298.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| LFL98_RS13030 (LFL98_13035) | yqeB | 2510892..2511614 (+) | 723 | WP_042976542.1 | hypothetical protein | - |
| LFL98_RS13035 (LFL98_13040) | nucA/comI | 2511647..2512057 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| LFL98_RS13040 (LFL98_13045) | - | 2512253..2512597 (+) | 345 | Protein_2519 | sigma-70 family RNA polymerase sigma factor | - |
| LFL98_RS13045 (LFL98_13050) | - | 2512743..2513213 (+) | 471 | WP_015251668.1 | MarR family transcriptional regulator | - |
| LFL98_RS13050 (LFL98_13055) | - | 2513364..2514776 (+) | 1413 | WP_277736543.1 | MDR family MFS transporter | - |
| LFL98_RS13055 (LFL98_13060) | spoIVCA | 2514963..2516423 (-) | 1461 | WP_277737219.1 | site-specific DNA recombinase SpoIVCA | - |
| LFL98_RS13060 (LFL98_13065) | - | 2516381..2516559 (-) | 179 | Protein_2523 | hypothetical protein | - |
| LFL98_RS13065 (LFL98_13070) | - | 2517209..2518306 (-) | 1098 | WP_032726210.1 | glycosyl hydrolase | - |
| LFL98_RS13070 (LFL98_13075) | - | 2518808..2518897 (-) | 90 | Protein_2525 | hypothetical protein | - |
| LFL98_RS13075 (LFL98_13080) | - | 2519233..2520360 (-) | 1128 | WP_038429342.1 | Rap family tetratricopeptide repeat protein | - |
| LFL98_RS13080 (LFL98_13085) | - | 2520546..2522438 (+) | 1893 | WP_163130600.1 | T7SS effector LXG polymorphic toxin | - |
| LFL98_RS13085 (LFL98_13090) | cdiI | 2522460..2522819 (+) | 360 | WP_040082462.1 | ribonuclease toxin immunity protein CdiI | - |
| LFL98_RS13090 (LFL98_13095) | - | 2522871..2523206 (+) | 336 | WP_069322770.1 | tRNA-Val4 | - |
| LFL98_RS13095 (LFL98_13100) | - | 2523267..2523707 (+) | 441 | WP_277736544.1 | SMI1/KNR4 family protein | - |
| LFL98_RS13100 (LFL98_13105) | - | 2523806..2524156 (+) | 351 | WP_250620785.1 | SMI1/KNR4 family protein | - |
| LFL98_RS13105 (LFL98_13110) | - | 2524454..2524999 (-) | 546 | WP_069322772.1 | SMI1/KNR4 family protein | - |
| LFL98_RS13110 (LFL98_13115) | - | 2525019..2526011 (-) | 993 | WP_224912955.1 | HNH endonuclease signature motif containing protein | - |
| LFL98_RS13115 (LFL98_13120) | - | 2526144..2526962 (-) | 819 | WP_277736545.1 | N-acetylmuramoyl-L-alanine amidase | - |
| LFL98_RS13120 (LFL98_13125) | - | 2527007..2527147 (-) | 141 | Protein_2535 | phage holin family protein | - |
| LFL98_RS13125 (LFL98_13130) | - | 2527174..2527359 (-) | 186 | Protein_2536 | phage terminase large subunit | - |
| LFL98_RS13130 (LFL98_13135) | terS | 2527356..2528126 (-) | 771 | Protein_2537 | phage terminase small subunit | - |
| LFL98_RS13135 (LFL98_13140) | - | 2528309..2528395 (+) | 87 | WP_073991391.1 | YjcZ family sporulation protein | - |
| LFL98_RS13140 (LFL98_13145) | - | 2528436..2528528 (+) | 93 | WP_088326573.1 | YjcZ family sporulation protein | - |
| LFL98_RS13145 (LFL98_13150) | - | 2528716..2528931 (-) | 216 | WP_277736546.1 | CotD family spore coat protein | - |
| LFL98_RS13150 (LFL98_13155) | - | 2529488..2529897 (-) | 410 | Protein_2541 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| LFL98_RS13155 (LFL98_13160) | - | 2530195..2530461 (+) | 267 | WP_029318115.1 | hypothetical protein | - |
| LFL98_RS13160 (LFL98_13165) | - | 2530565..2530748 (-) | 184 | Protein_2543 | hypothetical protein | - |
| LFL98_RS13165 (LFL98_13170) | - | 2530820..2531026 (-) | 207 | Protein_2544 | XtrA/YqaO family protein | - |
| LFL98_RS13170 (LFL98_13175) | yqaN | 2531110..2531529 (-) | 420 | Protein_2545 | RusA family crossover junction endodeoxyribonuclease | - |
| LFL98_RS13175 (LFL98_13180) | - | 2531625..2531773 (-) | 149 | Protein_2546 | hypothetical protein | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=754636 LFL98_RS13035 WP_009967785.1 2511647..2512057(-) (nucA/comI) [Bacillus subtilis strain HY2-62]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=754636 LFL98_RS13035 WP_009967785.1 2511647..2512057(-) (nucA/comI) [Bacillus subtilis strain HY2-62]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTACCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTACCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |