Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   OM992_RS12940 Genome accession   NZ_CP110268
Coordinates   2535346..2535519 (+) Length   57 a.a.
NCBI ID   WP_016938977.1    Uniprot ID   -
Organism   Bacillus siamensis strain YB-1631     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2530346..2540519
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OM992_RS12925 (OM992_12925) gcvT 2531158..2532258 (-) 1101 WP_264820323.1 glycine cleavage system aminomethyltransferase GcvT -
  OM992_RS12930 (OM992_12930) - 2532683..2534353 (+) 1671 WP_045926712.1 DEAD/DEAH box helicase -
  OM992_RS12935 (OM992_12935) - 2534375..2535169 (+) 795 WP_264818822.1 YqhG family protein -
  OM992_RS12940 (OM992_12940) sinI 2535346..2535519 (+) 174 WP_016938977.1 anti-repressor SinI Regulator
  OM992_RS12945 (OM992_12945) sinR 2535553..2535888 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  OM992_RS12950 (OM992_12950) tasA 2535936..2536721 (-) 786 WP_047475632.1 biofilm matrix protein TasA -
  OM992_RS12955 (OM992_12955) sipW 2536785..2537369 (-) 585 WP_264818823.1 signal peptidase I SipW -
  OM992_RS12960 (OM992_12960) tapA 2537341..2538012 (-) 672 WP_264818824.1 amyloid fiber anchoring/assembly protein TapA -
  OM992_RS12965 (OM992_12965) - 2538271..2538600 (+) 330 WP_016938972.1 DUF3889 domain-containing protein -
  OM992_RS12970 (OM992_12970) - 2538639..2538818 (-) 180 WP_016938971.1 YqzE family protein -
  OM992_RS12975 (OM992_12975) comGG 2538875..2539252 (-) 378 WP_047475629.1 competence type IV pilus minor pilin ComGG Machinery gene
  OM992_RS12980 (OM992_12980) comGF 2539253..2539753 (-) 501 WP_264818825.1 competence type IV pilus minor pilin ComGF -
  OM992_RS12985 (OM992_12985) comGE 2539662..2539976 (-) 315 WP_264818826.1 competence type IV pilus minor pilin ComGE -
  OM992_RS12990 (OM992_12990) comGD 2539960..2540397 (-) 438 WP_045926719.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6719.70 Da        Isoelectric Point: 9.8173

>NTDB_id=753667 OM992_RS12940 WP_016938977.1 2535346..2535519(+) (sinI) [Bacillus siamensis strain YB-1631]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=753667 OM992_RS12940 WP_016938977.1 2535346..2535519(+) (sinI) [Bacillus siamensis strain YB-1631]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTGGAAGAAATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684