Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | OKV75_RS03455 | Genome accession | NZ_CP110109 |
| Coordinates | 692287..692565 (+) | Length | 92 a.a. |
| NCBI ID | WP_216115471.1 | Uniprot ID | - |
| Organism | Bacillus thuringiensis strain TG-5 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 683458..726527 | 692287..692565 | within | 0 |
Gene organization within MGE regions
Location: 683458..726527
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKV75_RS03385 | - | 683458..683721 (+) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
| OKV75_RS03390 | - | 684271..684582 (+) | 312 | WP_141549902.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| OKV75_RS03395 | - | 684735..684866 (+) | 132 | Protein_678 | site-specific integrase | - |
| OKV75_RS03400 | - | 685076..685561 (+) | 486 | WP_071714876.1 | homoserine dehydrogenase | - |
| OKV75_RS03405 | - | 685873..686574 (+) | 702 | WP_216115466.1 | pPIWI_RE module domain-containing protein | - |
| OKV75_RS03410 | - | 686613..687722 (-) | 1110 | WP_264647994.1 | site-specific integrase | - |
| OKV75_RS03415 | - | 688270..689421 (+) | 1152 | WP_264647995.1 | AimR family lysis-lysogeny pheromone receptor | - |
| OKV75_RS03420 | - | 689459..689605 (+) | 147 | WP_000720921.1 | hypothetical protein | - |
| OKV75_RS03425 | - | 689761..689889 (+) | 129 | WP_002162786.1 | hypothetical protein | - |
| OKV75_RS03430 | - | 689927..690280 (-) | 354 | WP_000491236.1 | helix-turn-helix domain-containing protein | - |
| OKV75_RS03435 | - | 690481..690672 (+) | 192 | WP_000854271.1 | helix-turn-helix domain-containing protein | - |
| OKV75_RS03440 | - | 690728..690994 (+) | 267 | WP_000522030.1 | helix-turn-helix domain-containing protein | - |
| OKV75_RS03445 | - | 690994..691158 (+) | 165 | WP_216115469.1 | hypothetical protein | - |
| OKV75_RS03450 | - | 691216..692283 (+) | 1068 | WP_216115470.1 | DnaD domain-containing protein | - |
| OKV75_RS03455 | abrB | 692287..692565 (+) | 279 | WP_216115471.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| OKV75_RS03460 | - | 692558..692917 (+) | 360 | WP_102956504.1 | cell division protein SepF | - |
| OKV75_RS03465 | - | 692936..693103 (+) | 168 | WP_102956505.1 | DUF3954 domain-containing protein | - |
| OKV75_RS03470 | - | 693129..693380 (+) | 252 | WP_102956506.1 | helix-turn-helix domain containing protein | - |
| OKV75_RS03475 | - | 693401..693883 (+) | 483 | WP_216115472.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| OKV75_RS03480 | - | 694100..694291 (+) | 192 | WP_216115473.1 | hypothetical protein | - |
| OKV75_RS03485 | - | 694311..694499 (+) | 189 | WP_216115474.1 | hypothetical protein | - |
| OKV75_RS03490 | - | 694584..695048 (-) | 465 | WP_046392730.1 | hypothetical protein | - |
| OKV75_RS03495 | - | 695895..696464 (-) | 570 | WP_001199851.1 | cupin domain-containing protein | - |
| OKV75_RS03500 | - | 697585..698865 (-) | 1281 | WP_216115475.1 | BclA C-terminal domain-containing protein | - |
| OKV75_RS03505 | - | 700849..701331 (+) | 483 | WP_216115476.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| OKV75_RS03510 | - | 701331..701873 (+) | 543 | WP_264647996.1 | site-specific integrase | - |
| OKV75_RS03515 | - | 702087..703037 (+) | 951 | WP_216115478.1 | nucleoside hydrolase | - |
| OKV75_RS03520 | - | 703838..705007 (+) | 1170 | WP_016081850.1 | serine hydrolase | - |
| OKV75_RS03525 | - | 705336..705911 (+) | 576 | WP_166696009.1 | DUF2441 domain-containing protein | - |
| OKV75_RS03530 | - | 706248..706460 (+) | 213 | WP_016077624.1 | hypothetical protein | - |
| OKV75_RS03535 | - | 706596..706850 (+) | 255 | WP_166696012.1 | hypothetical protein | - |
| OKV75_RS03540 | - | 706840..707217 (+) | 378 | WP_166696014.1 | HNH endonuclease | - |
| OKV75_RS03545 | - | 707347..707850 (+) | 504 | WP_216115479.1 | phage terminase small subunit P27 family | - |
| OKV75_RS03550 | - | 707852..709546 (+) | 1695 | WP_216115480.1 | terminase large subunit | - |
| OKV75_RS03555 | - | 709735..710988 (+) | 1254 | WP_216115481.1 | phage portal protein | - |
| OKV75_RS03560 | - | 710975..711685 (+) | 711 | WP_216115482.1 | head maturation protease, ClpP-related | - |
| OKV75_RS03565 | - | 711723..712895 (+) | 1173 | WP_216115483.1 | phage major capsid protein | - |
| OKV75_RS03570 | - | 712916..713203 (+) | 288 | WP_216115484.1 | head-tail connector protein | - |
| OKV75_RS03575 | - | 713190..713513 (+) | 324 | WP_216115485.1 | phage head closure protein | - |
| OKV75_RS03580 | - | 713506..713940 (+) | 435 | WP_000763220.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| OKV75_RS03585 | - | 713937..714296 (+) | 360 | WP_264647997.1 | DUF3168 domain-containing protein | - |
| OKV75_RS03590 | - | 714297..714902 (+) | 606 | WP_006921167.1 | major tail protein | - |
| OKV75_RS03595 | gpG | 714949..715266 (+) | 318 | WP_216115487.1 | phage tail assembly chaperone G | - |
| OKV75_RS03600 | - | 715296..715472 (+) | 177 | WP_000344056.1 | hypothetical protein | - |
| OKV75_RS03605 | - | 715488..716768 (+) | 1281 | Protein_720 | phage tail tape measure protein | - |
| OKV75_RS03610 | - | 717033..719603 (+) | 2571 | Protein_721 | phage tail tape measure protein | - |
| OKV75_RS03615 | - | 719618..721099 (+) | 1482 | WP_047386250.1 | distal tail protein Dit | - |
| OKV75_RS03620 | - | 721096..725127 (+) | 4032 | WP_264647998.1 | phage tail spike protein | - |
| OKV75_RS03625 | - | 725167..725592 (+) | 426 | WP_216115491.1 | holin family protein | - |
| OKV75_RS03630 | - | 725592..726527 (+) | 936 | WP_216115492.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10080.61 Da Isoelectric Point: 5.1546
>NTDB_id=752358 OKV75_RS03455 WP_216115471.1 692287..692565(+) (abrB) [Bacillus thuringiensis strain TG-5]
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGASEL
LNFIQKSGLADA
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGASEL
LNFIQKSGLADA
Nucleotide
Download Length: 279 bp
>NTDB_id=752358 OKV75_RS03455 WP_216115471.1 692287..692565(+) (abrB) [Bacillus thuringiensis strain TG-5]
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAACATTGTTCTAAGGAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAAGTGAATTA
CTGAATTTTATTCAGAAGAGTGGGCTGGCAGATGCCTAA
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAACATTGTTCTAAGGAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAAGTGAATTA
CTGAATTTTATTCAGAAGAGTGGGCTGGCAGATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
60.92 |
94.565 |
0.576 |