Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   OKV75_RS01685 Genome accession   NZ_CP110109
Coordinates   326051..326329 (+) Length   92 a.a.
NCBI ID   WP_000799099.1    Uniprot ID   -
Organism   Bacillus thuringiensis strain TG-5     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 318992..332569 326051..326329 within 0


Gene organization within MGE regions


Location: 318992..332569
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OKV75_RS01625 - 318992..320098 (-) 1107 WP_000675846.1 site-specific integrase -
  OKV75_RS01630 - 320303..320458 (+) 156 WP_216115433.1 hypothetical protein -
  OKV75_RS01635 - 320960..322153 (+) 1194 WP_000368811.1 AimR family lysis-lysogeny pheromone receptor -
  OKV75_RS01640 - 322194..322346 (+) 153 WP_000723681.1 hypothetical protein -
  OKV75_RS01645 - 322506..322643 (+) 138 WP_000389115.1 hypothetical protein -
  OKV75_RS01650 - 322673..323032 (-) 360 WP_000427704.1 helix-turn-helix domain-containing protein -
  OKV75_RS01655 - 323203..323406 (+) 204 WP_000163954.1 helix-turn-helix domain-containing protein -
  OKV75_RS01660 - 323611..323877 (+) 267 WP_000522022.1 helix-turn-helix domain-containing protein -
  OKV75_RS01665 - 323877..324041 (+) 165 WP_000390297.1 hypothetical protein -
  OKV75_RS01670 - 324252..325010 (+) 759 WP_264647909.1 DnaD domain protein -
  OKV75_RS01675 - 324949..325824 (+) 876 WP_002093995.1 ATP-binding protein -
  OKV75_RS01680 - 325840..326034 (+) 195 WP_264647910.1 hypothetical protein -
  OKV75_RS01685 abrB 326051..326329 (+) 279 WP_000799099.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  OKV75_RS01690 - 326322..326681 (+) 360 WP_001118821.1 hypothetical protein -
  OKV75_RS01695 - 326700..326867 (+) 168 WP_000717825.1 DUF3954 domain-containing protein -
  OKV75_RS01700 - 326893..327144 (+) 252 WP_098158430.1 helix-turn-helix domain containing protein -
  OKV75_RS01705 - 327164..327619 (+) 456 WP_264647911.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  OKV75_RS01710 - 327659..327820 (+) 162 WP_176544616.1 hypothetical protein -
  OKV75_RS01715 - 328060..328227 (+) 168 WP_193653553.1 hypothetical protein -
  OKV75_RS01720 - 328769..328903 (+) 135 WP_257147130.1 hypothetical protein -
  OKV75_RS01725 - 329173..329481 (-) 309 WP_264647912.1 hypothetical protein -
  OKV75_RS01730 - 329612..330088 (-) 477 WP_371128375.1 restriction endonuclease -
  OKV75_RS01735 - 330346..331179 (+) 834 WP_098861681.1 hypothetical protein -
  OKV75_RS01740 - 331369..331539 (+) 171 WP_088338595.1 hypothetical protein -
  OKV75_RS01745 - 331560..332030 (+) 471 WP_088338594.1 ArpU family phage packaging/lysis transcriptional regulator -
  OKV75_RS01750 - 332027..332569 (+) 543 WP_001028525.1 site-specific integrase -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10078.66 Da        Isoelectric Point: 6.2285

>NTDB_id=752356 OKV75_RS01685 WP_000799099.1 326051..326329(+) (abrB) [Bacillus thuringiensis strain TG-5]
MKNTGVSRKVDELGRVVIPVELRRTLGIAEGTALGFHVEGGDIVLRKHEKSCFVTGKVSESNIELLDGRMFLSKEGVTEL
LDILEKSEMAHG

Nucleotide


Download         Length: 279 bp        

>NTDB_id=752356 OKV75_RS01685 WP_000799099.1 326051..326329(+) (abrB) [Bacillus thuringiensis strain TG-5]
ATGAAAAACACAGGTGTTTCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAGTAGAGTTACGTAGAACTTTAGG
AATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGGGGAGACATTGTTTTAAGAAAACACGAAAAGTCATGCTTTG
TAACTGGCAAAGTTTCGGAATCAAACATTGAATTACTGGATGGAAGAATGTTTCTAAGTAAAGAAGGAGTAACTGAATTA
CTGGACATTCTTGAAAAGAGTGAAATGGCACATGGCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

55.422

90.217

0.5