Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   OKW88_RS09755 Genome accession   NZ_CP110105
Coordinates   1896849..1896989 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain CF03     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1891849..1901989
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OKW88_RS09730 (OKW88_09715) yuxO 1892201..1892581 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  OKW88_RS09735 (OKW88_09720) comA 1892600..1893234 (-) 635 Protein_1915 two-component system response regulator ComA -
  OKW88_RS09740 (OKW88_09725) comP 1893315..1895615 (-) 2301 WP_088300729.1 histidine kinase Regulator
  OKW88_RS09745 (OKW88_09730) comX 1895627..1895791 (-) 165 WP_015384519.1 competence pheromone ComX -
  OKW88_RS09750 (OKW88_09735) - 1895804..1896664 (-) 861 WP_407568091.1 polyprenyl synthetase family protein -
  OKW88_RS09755 (OKW88_09740) degQ 1896849..1896989 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  OKW88_RS09760 (OKW88_09745) - 1897211..1897336 (+) 126 WP_003228793.1 hypothetical protein -
  OKW88_RS09765 (OKW88_09750) - 1897450..1897818 (+) 369 WP_014477834.1 hypothetical protein -
  OKW88_RS09770 (OKW88_09755) pdeH 1897794..1899023 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  OKW88_RS09775 (OKW88_09760) pncB 1899160..1900632 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  OKW88_RS09780 (OKW88_09765) pncA 1900648..1901199 (-) 552 WP_015714627.1 cysteine hydrolase family protein -
  OKW88_RS09785 (OKW88_09770) yueI 1901296..1901694 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=752281 OKW88_RS09755 WP_003220708.1 1896849..1896989(-) (degQ) [Bacillus subtilis strain CF03]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=752281 OKW88_RS09755 WP_003220708.1 1896849..1896989(-) (degQ) [Bacillus subtilis strain CF03]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1