Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | OK229_RS12725 | Genome accession | NZ_CP109872 |
| Coordinates | 2453123..2453401 (+) | Length | 92 a.a. |
| NCBI ID | WP_264457288.1 | Uniprot ID | A0AAE9PC10 |
| Organism | Bacillus cereus strain BC38B | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2442169..2484844 | 2453123..2453401 | within | 0 |
Gene organization within MGE regions
Location: 2442169..2484844
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK229_RS29280 | - | 2442169..2442630 (+) | 462 | WP_001982105.1 | hypothetical protein | - |
| OK229_RS29285 | - | 2442591..2442821 (+) | 231 | WP_000381010.1 | hypothetical protein | - |
| OK229_RS12635 (OK229_22455) | - | 2443199..2443363 (+) | 165 | WP_001099235.1 | hypothetical protein | - |
| OK229_RS12640 (OK229_22460) | - | 2443447..2443659 (+) | 213 | WP_001148160.1 | hypothetical protein | - |
| OK229_RS12645 (OK229_22465) | - | 2443832..2444038 (-) | 207 | WP_264457259.1 | hypothetical protein | - |
| OK229_RS12650 (OK229_22470) | - | 2444686..2445150 (-) | 465 | WP_000796386.1 | hypothetical protein | - |
| OK229_RS12655 (OK229_22475) | - | 2445259..2445393 (-) | 135 | WP_001051664.1 | hypothetical protein | - |
| OK229_RS12660 (OK229_22480) | - | 2445731..2446387 (+) | 657 | Protein_2418 | DUF3962 domain-containing protein | - |
| OK229_RS12665 (OK229_22485) | - | 2446471..2447580 (-) | 1110 | WP_264457266.1 | tyrosine-type recombinase/integrase | - |
| OK229_RS12670 (OK229_22490) | - | 2448125..2449276 (+) | 1152 | WP_264457268.1 | AimR family lysis-lysogeny pheromone receptor | - |
| OK229_RS12675 (OK229_22495) | - | 2449314..2449460 (+) | 147 | WP_264457270.1 | complement C1q protein | - |
| OK229_RS12680 (OK229_22500) | - | 2449615..2449743 (+) | 129 | WP_264457272.1 | hypothetical protein | - |
| OK229_RS12685 (OK229_22505) | - | 2449779..2450132 (-) | 354 | WP_264457274.1 | helix-turn-helix transcriptional regulator | - |
| OK229_RS12690 (OK229_22510) | - | 2450332..2450523 (+) | 192 | WP_000854271.1 | helix-turn-helix transcriptional regulator | - |
| OK229_RS12695 (OK229_22515) | - | 2450580..2450846 (+) | 267 | WP_088122881.1 | helix-turn-helix domain-containing protein | - |
| OK229_RS12700 (OK229_22520) | - | 2450846..2451010 (+) | 165 | WP_264457278.1 | hypothetical protein | - |
| OK229_RS12705 (OK229_22525) | - | 2451040..2451216 (+) | 177 | WP_264457280.1 | hypothetical protein | - |
| OK229_RS12710 (OK229_22530) | - | 2451223..2452098 (+) | 876 | WP_264457282.1 | DnaD domain protein | - |
| OK229_RS12715 (OK229_22535) | - | 2452046..2452909 (+) | 864 | WP_264457284.1 | ATP-binding protein | - |
| OK229_RS12720 (OK229_22540) | - | 2452912..2453106 (+) | 195 | WP_264457286.1 | hypothetical protein | - |
| OK229_RS12725 (OK229_22545) | abrB | 2453123..2453401 (+) | 279 | WP_264457288.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| OK229_RS12730 (OK229_22550) | - | 2453394..2453753 (+) | 360 | WP_264457290.1 | cell division protein SepF | - |
| OK229_RS12735 (OK229_22555) | - | 2453772..2453939 (+) | 168 | WP_098673414.1 | DUF3954 domain-containing protein | - |
| OK229_RS12740 (OK229_22560) | - | 2453965..2454216 (+) | 252 | WP_264457294.1 | helix-turn-helix domain containing protein | - |
| OK229_RS12745 (OK229_22565) | - | 2454236..2454745 (+) | 510 | WP_264457296.1 | dUTP diphosphatase | - |
| OK229_RS12750 (OK229_22570) | - | 2454938..2456881 (-) | 1944 | WP_264457298.1 | collagen-like repeat preface domain-containing protein | - |
| OK229_RS12755 (OK229_22575) | - | 2458365..2458577 (+) | 213 | WP_264457300.1 | hypothetical protein | - |
| OK229_RS12760 (OK229_22580) | - | 2458611..2458793 (+) | 183 | WP_264457302.1 | hypothetical protein | - |
| OK229_RS12765 (OK229_22585) | - | 2458864..2459550 (-) | 687 | WP_264457304.1 | CPBP family glutamic-type intramembrane protease | - |
| OK229_RS12770 (OK229_22590) | - | 2459759..2459881 (+) | 123 | WP_264457306.1 | DUF3983 domain-containing protein | - |
| OK229_RS12775 (OK229_22595) | - | 2459902..2460084 (+) | 183 | WP_264457308.1 | hypothetical protein | - |
| OK229_RS12780 (OK229_22600) | - | 2460196..2460366 (+) | 171 | WP_264457310.1 | hypothetical protein | - |
| OK229_RS12785 (OK229_22605) | - | 2460394..2460876 (+) | 483 | WP_098156127.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| OK229_RS12790 (OK229_22610) | - | 2460876..2461418 (+) | 543 | WP_264457314.1 | site-specific integrase | - |
| OK229_RS12795 (OK229_22615) | - | 2461659..2462594 (+) | 936 | WP_071735824.1 | DUF6731 family protein | - |
| OK229_RS12800 (OK229_22620) | - | 2462615..2463136 (+) | 522 | WP_264457318.1 | hypothetical protein | - |
| OK229_RS12805 (OK229_22625) | - | 2463600..2463788 (+) | 189 | WP_264457321.1 | ATPase | - |
| OK229_RS12810 (OK229_22630) | - | 2463855..2464730 (+) | 876 | WP_264457323.1 | hypothetical protein | - |
| OK229_RS12815 (OK229_22635) | - | 2464782..2465003 (+) | 222 | WP_264457325.1 | hypothetical protein | - |
| OK229_RS12820 (OK229_22640) | - | 2465010..2465183 (+) | 174 | WP_264457327.1 | hypothetical protein | - |
| OK229_RS12825 (OK229_22645) | - | 2465176..2465511 (+) | 336 | WP_264457329.1 | HNH endonuclease | - |
| OK229_RS12830 (OK229_22650) | - | 2465634..2465945 (+) | 312 | WP_063537144.1 | P27 family phage terminase small subunit | - |
| OK229_RS12835 (OK229_22655) | - | 2465942..2467609 (+) | 1668 | WP_264457333.1 | terminase TerL endonuclease subunit | - |
| OK229_RS12840 (OK229_22660) | - | 2467618..2468763 (+) | 1146 | WP_264457335.1 | phage portal protein | - |
| OK229_RS12845 (OK229_22665) | - | 2468763..2469506 (+) | 744 | WP_264457337.1 | head maturation protease, ClpP-related | - |
| OK229_RS12850 (OK229_22670) | - | 2469510..2470664 (+) | 1155 | WP_264457339.1 | phage major capsid protein | - |
| OK229_RS12855 (OK229_22675) | - | 2470670..2470963 (+) | 294 | WP_044791522.1 | hypothetical protein | - |
| OK229_RS12860 (OK229_22680) | - | 2470965..2471318 (+) | 354 | WP_264457343.1 | phage head closure protein | - |
| OK229_RS12865 (OK229_22685) | - | 2471320..2471664 (+) | 345 | WP_264457345.1 | HK97 gp10 family phage protein | - |
| OK229_RS12870 (OK229_22690) | - | 2471661..2471990 (+) | 330 | WP_264457347.1 | hypothetical protein | - |
| OK229_RS12875 (OK229_22695) | - | 2471991..2472587 (+) | 597 | WP_264457349.1 | major tail protein | - |
| OK229_RS12880 (OK229_22700) | - | 2472594..2472938 (+) | 345 | WP_264457351.1 | hypothetical protein | - |
| OK229_RS12885 (OK229_22705) | - | 2473007..2473156 (+) | 150 | WP_000338226.1 | hypothetical protein | - |
| OK229_RS12890 (OK229_22710) | - | 2473174..2474382 (+) | 1209 | Protein_2464 | hypothetical protein | - |
| OK229_RS12895 (OK229_22715) | - | 2474895..2477828 (+) | 2934 | WP_264459884.1 | hypothetical protein | - |
| OK229_RS12900 (OK229_22720) | - | 2477870..2479351 (+) | 1482 | WP_264457354.1 | distal tail protein Dit | - |
| OK229_RS12905 (OK229_22725) | - | 2479348..2483211 (+) | 3864 | WP_264457356.1 | phage tail spike protein | - |
| OK229_RS12910 (OK229_22730) | - | 2483305..2483541 (+) | 237 | WP_073516187.1 | hemolysin XhlA family protein | - |
| OK229_RS12915 (OK229_22735) | - | 2483541..2483780 (+) | 240 | WP_000253962.1 | hypothetical protein | - |
| OK229_RS12920 (OK229_22740) | - | 2483777..2484844 (+) | 1068 | WP_264457363.1 | peptidoglycan recognition family protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10006.54 Da Isoelectric Point: 5.1487
>NTDB_id=750329 OK229_RS12725 WP_264457288.1 2453123..2453401(+) (abrB) [Bacillus cereus strain BC38B]
MKNTGVTRKVDELGRVVIPVELRRTLGIAEGAALDIHVDGENVVLSKQEKSCFVTGEVSETNIVLLNGRMFLSKEGATEL
LNILEKSEMAHG
MKNTGVTRKVDELGRVVIPVELRRTLGIAEGAALDIHVDGENVVLSKQEKSCFVTGEVSETNIVLLNGRMFLSKEGATEL
LNILEKSEMAHG
Nucleotide
Download Length: 279 bp
>NTDB_id=750329 OK229_RS12725 WP_264457288.1 2453123..2453401(+) (abrB) [Bacillus cereus strain BC38B]
ATGAAAAACACAGGCGTTACGAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGAGCAGCGCTAGACATTCATGTTGATGGGGAAAATGTTGTTCTAAGTAAACAAGAAAAATCATGCTTTG
TAACAGGTGAGGTTTCTGAAACAAATATAGTTTTGCTAAACGGACGAATGTTTTTAAGTAAGGAAGGAGCAACTGAATTA
CTGAACATTCTTGAAAAGAGTGAGATGGCACATGGCTAA
ATGAAAAACACAGGCGTTACGAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGAGCAGCGCTAGACATTCATGTTGATGGGGAAAATGTTGTTCTAAGTAAACAAGAAAAATCATGCTTTG
TAACAGGTGAGGTTTCTGAAACAAATATAGTTTTGCTAAACGGACGAATGTTTTTAAGTAAGGAAGGAGCAACTGAATTA
CTGAACATTCTTGAAAAGAGTGAGATGGCACATGGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
59.524 |
91.304 |
0.543 |