Detailed information    

insolico Bioinformatically predicted

Overview


Name   dprA   Type   Machinery gene
Locus tag   L0P93_RS09215 Genome accession   NZ_CP109795
Coordinates   1764228..1765127 (+) Length   299 a.a.
NCBI ID   WP_014417764.1    Uniprot ID   -
Organism   Bacillus velezensis strain B19     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1746693..1799189 1764228..1765127 within 0


Gene organization within MGE regions


Location: 1746693..1799189
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L0P93_RS09120 (L0P93_09135) acpP 1746772..1747005 (+) 234 WP_003154310.1 acyl carrier protein -
  L0P93_RS09125 (L0P93_09140) rncS 1747144..1747893 (+) 750 WP_014417754.1 ribonuclease III -
  L0P93_RS09130 (L0P93_09145) smc 1747995..1751555 (+) 3561 WP_029973477.1 chromosome segregation protein SMC -
  L0P93_RS09135 (L0P93_09150) ftsY 1751575..1752564 (+) 990 WP_003154301.1 signal recognition particle-docking protein FtsY -
  L0P93_RS09140 (L0P93_09155) - 1752648..1753418 (+) 771 WP_025649467.1 aminoglycoside phosphotransferase family protein -
  L0P93_RS09145 (L0P93_09160) - 1753540..1753872 (+) 333 WP_003154299.1 putative DNA-binding protein -
  L0P93_RS09150 (L0P93_09165) ffh 1753886..1755226 (+) 1341 WP_265606280.1 signal recognition particle protein -
  L0P93_RS09155 (L0P93_09170) rpsP 1755332..1755604 (+) 273 WP_003154296.1 30S ribosomal protein S16 -
  L0P93_RS09160 (L0P93_09175) - 1755604..1755849 (+) 246 WP_007611392.1 KH domain-containing protein -
  L0P93_RS09165 (L0P93_09180) - 1755940..1756326 (+) 387 WP_003154291.1 YlqD family protein -
  L0P93_RS09170 (L0P93_09185) rimM 1756331..1756855 (+) 525 WP_277161326.1 ribosome maturation factor RimM -
  L0P93_RS09175 (L0P93_09190) trmD 1756852..1757583 (+) 732 WP_022553353.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  L0P93_RS09180 (L0P93_09195) rplS 1757724..1758071 (+) 348 WP_003154288.1 50S ribosomal protein L19 -
  L0P93_RS09185 (L0P93_09200) ylqF 1758214..1759062 (+) 849 WP_007611396.1 ribosome biogenesis GTPase YlqF -
  L0P93_RS09190 (L0P93_09205) - 1759135..1759902 (+) 768 WP_029973475.1 ribonuclease HII -
  L0P93_RS09195 (L0P93_09210) - 1759919..1761622 (+) 1704 WP_277161327.1 glycosyl transferase -
  L0P93_RS09200 (L0P93_09215) - 1761619..1761900 (+) 282 WP_014417762.1 FlhB-like flagellar biosynthesis protein -
  L0P93_RS09205 (L0P93_09220) sucC 1762075..1763232 (+) 1158 WP_003154283.1 ADP-forming succinate--CoA ligase subunit beta -
  L0P93_RS09210 (L0P93_09225) sucD 1763261..1764163 (+) 903 WP_014417763.1 succinate--CoA ligase subunit alpha -
  L0P93_RS09215 (L0P93_09230) dprA 1764228..1765127 (+) 900 WP_014417764.1 DNA-processing protein DprA Machinery gene
  L0P93_RS09220 (L0P93_09235) topA 1765309..1767384 (+) 2076 WP_014417765.1 type I DNA topoisomerase -
  L0P93_RS09225 (L0P93_09240) trmFO 1767449..1768756 (+) 1308 WP_029973471.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  L0P93_RS09230 (L0P93_09245) xerC 1768826..1769743 (+) 918 WP_007409774.1 tyrosine recombinase XerC -
  L0P93_RS09235 (L0P93_09250) hslV 1769759..1770301 (+) 543 WP_277161328.1 ATP-dependent protease subunit HslV -
  L0P93_RS09240 (L0P93_09255) hslU 1770318..1771719 (+) 1402 Protein_1760 HslU--HslV peptidase ATPase subunit -
  L0P93_RS09245 (L0P93_09260) codY 1771757..1772535 (+) 779 Protein_1761 GTP-sensing pleiotropic transcriptional regulator CodY -
  L0P93_RS09250 (L0P93_09265) flgB 1772889..1773278 (+) 390 WP_003154260.1 flagellar basal body rod protein FlgB -
  L0P93_RS09255 (L0P93_09270) flgC 1773278..1773730 (+) 453 WP_015239851.1 flagellar basal body rod protein FlgC -
  L0P93_RS09260 (L0P93_09275) fliE 1773741..1774061 (+) 321 WP_029973469.1 flagellar hook-basal body complex protein FliE -
  L0P93_RS09265 (L0P93_09280) fliF 1774104..1775714 (+) 1611 WP_099721951.1 flagellar basal-body MS-ring/collar protein FliF -
  L0P93_RS09270 (L0P93_09285) fliG 1775727..1776743 (+) 1017 WP_003154256.1 flagellar motor switch protein FliG -
  L0P93_RS09275 (L0P93_09290) fliH 1776736..1777491 (+) 756 WP_017417778.1 flagellar assembly protein FliH -
  L0P93_RS09280 (L0P93_09295) fliI 1777488..1778804 (+) 1317 WP_007611430.1 flagellar protein export ATPase FliI -
  L0P93_RS09285 (L0P93_09300) fliJ 1778810..1779253 (+) 444 WP_003154253.1 flagellar export protein FliJ -
  L0P93_RS09290 (L0P93_09305) - 1779265..1779874 (+) 610 Protein_1770 MotE family protein -
  L0P93_RS09295 (L0P93_09310) - 1779881..1781224 (+) 1344 WP_029973466.1 flagellar hook-length control protein FliK -
  L0P93_RS09300 (L0P93_09315) flgD 1781225..1781665 (+) 441 WP_029973465.1 flagellar hook assembly protein FlgD -
  L0P93_RS09305 (L0P93_09320) flgG 1781690..1782466 (+) 777 WP_007409783.1 flagellar basal body rod protein FlgG -
  L0P93_RS09310 (L0P93_09325) - 1782506..1782721 (+) 216 WP_003154243.1 flagellar FlbD family protein -
  L0P93_RS09315 (L0P93_09330) fliL 1782718..1783137 (+) 420 WP_021493686.1 flagellar basal body-associated protein FliL -
  L0P93_RS09320 (L0P93_09335) fliM 1783171..1784169 (+) 999 WP_003154240.1 flagellar motor switch protein FliM -
  L0P93_RS09325 (L0P93_09340) fliY 1784159..1785295 (+) 1137 WP_021493685.1 flagellar motor switch phosphatase FliY -
  L0P93_RS09330 (L0P93_09345) cheY 1785322..1785684 (+) 363 WP_003154238.1 chemotaxis protein CheY -
  L0P93_RS09335 (L0P93_09350) fliZ 1785699..1786352 (+) 654 WP_022553343.1 flagella biosynthesis regulatory protein FliZ -
  L0P93_RS09340 (L0P93_09355) fliP 1786345..1787010 (+) 666 WP_007409786.1 flagellar type III secretion system pore protein FliP -
  L0P93_RS09345 (L0P93_09360) fliQ 1787025..1787294 (+) 270 WP_003154234.1 flagellar biosynthesis protein FliQ -
  L0P93_RS09350 (L0P93_09365) fliR 1787301..1788080 (+) 780 WP_014417775.1 flagellar biosynthetic protein FliR -
  L0P93_RS09355 (L0P93_09370) flhB 1788080..1789159 (+) 1080 WP_014417776.1 flagellar biosynthesis protein FlhB -
  L0P93_RS09360 (L0P93_09375) flhA 1789193..1791226 (+) 2034 WP_277161329.1 flagellar biosynthesis protein FlhA -
  L0P93_RS09365 (L0P93_09380) flhF 1791226..1792314 (+) 1089 WP_277161330.1 flagellar biosynthesis protein FlhF -
  L0P93_RS09370 (L0P93_09385) - 1792311..1793204 (+) 894 WP_104679021.1 MinD/ParA family protein -
  L0P93_RS09375 (L0P93_09390) - 1793201..1794268 (+) 1068 WP_007409791.1 chemotaxis response regulator protein-glutamate methylesterase -
  L0P93_RS09380 (L0P93_09395) cheA 1794274..1796292 (+) 2019 WP_021493681.1 chemotaxis protein CheA -
  L0P93_RS09385 (L0P93_09400) cheW 1796315..1796788 (+) 474 WP_003154225.1 chemotaxis protein CheW -
  L0P93_RS09390 (L0P93_09405) cheC 1796804..1797433 (+) 630 WP_014417781.1 CheY-P phosphatase CheC -
  L0P93_RS09395 (L0P93_09410) cheD 1797430..1797929 (+) 500 Protein_1791 chemoreceptor glutamine deamidase CheD -
  L0P93_RS09400 (L0P93_09415) sigD 1797956..1798720 (+) 765 WP_003154217.1 RNA polymerase sigma-28 factor SigD -

Sequence


Protein


Download         Length: 299 a.a.        Molecular weight: 32850.04 Da        Isoelectric Point: 8.4593

>NTDB_id=749238 L0P93_RS09215 WP_014417764.1 1764228..1765127(+) (dprA) [Bacillus velezensis strain B19]
MDQASRCLMVCSINQIISPSLLLKWWKADHSLSFLPDPHPLTVLSEGKTAPEAIFREIERKEPELDEVLSDYRRKGITVI
PISSSRYPTWLKAIYDPPAVLYAKGNTLLLEKGRKIGIVGTRKPTEDGIKAAGHLSAELSKKGWVIVSGLASGIDGLSHK
ASIRAKGLTIGVIAGGFHHIYPRENLLLAEYMAEHHLLLSEHPPETKPKKWHFPMRNRIISGLSEGIVVVQGKEKSGSLI
TAYQALDQGREVFAVPGSIFNPYSGGPIKLIQEGAKAVLCAEDIDGELTARCVQYTEPF

Nucleotide


Download         Length: 900 bp        

>NTDB_id=749238 L0P93_RS09215 WP_014417764.1 1764228..1765127(+) (dprA) [Bacillus velezensis strain B19]
TTGGATCAAGCATCGCGCTGTTTAATGGTCTGCAGTATTAATCAAATCATTTCCCCGTCTCTTCTATTAAAATGGTGGAA
AGCTGACCACTCTCTGTCTTTTTTACCGGATCCGCATCCATTAACTGTTTTATCAGAAGGGAAAACAGCCCCGGAAGCAA
TTTTTCGGGAAATAGAGCGCAAGGAACCGGAACTTGATGAAGTTCTGTCCGATTACCGCCGCAAAGGCATTACTGTCATT
CCGATTTCATCAAGCCGCTATCCAACATGGCTTAAAGCGATTTATGATCCGCCGGCTGTCTTGTATGCAAAAGGGAACAC
GCTGCTTCTTGAAAAAGGCAGAAAAATCGGGATTGTAGGAACGCGGAAACCGACGGAAGACGGAATAAAAGCGGCTGGGC
ATCTTTCCGCCGAACTCTCAAAAAAAGGCTGGGTCATTGTAAGCGGGCTTGCATCCGGTATAGACGGATTGTCTCATAAG
GCGAGCATCAGGGCAAAAGGGCTTACGATCGGCGTGATAGCCGGCGGATTCCATCATATCTATCCCCGGGAAAATCTCCT
GTTAGCAGAATACATGGCTGAACACCATCTCCTACTCTCAGAACATCCTCCTGAAACAAAGCCGAAAAAATGGCACTTTC
CGATGAGAAACCGCATAATCAGCGGACTAAGTGAAGGAATTGTGGTCGTGCAGGGAAAAGAAAAAAGCGGTTCATTAATC
ACAGCTTACCAGGCCCTCGATCAAGGCAGAGAGGTATTTGCCGTTCCGGGTTCCATATTTAATCCATATTCCGGAGGACC
TATAAAACTCATTCAAGAAGGGGCGAAAGCTGTATTATGCGCAGAGGATATTGACGGAGAGCTGACCGCCCGATGCGTTC
AGTATACGGAACCCTTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Bacillus subtilis subsp. subtilis str. 168

70.569

100

0.706

  dprA Lactococcus lactis subsp. cremoris KW2

41.288

88.294

0.365