Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   K6K00_RS16930 Genome accession   NZ_AP024628
Coordinates   3230558..3230698 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BEST3145     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3225558..3235698
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6K00_RS16905 (BsBEST3145_32700) yuxO 3225835..3226215 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  K6K00_RS16910 (BsBEST3145_32710) comA 3226234..3226878 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  K6K00_RS16915 (BsBEST3145_32720) comP 3226959..3229271 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  K6K00_RS16920 (BsBEST3145_32730) comX 3229287..3229508 (-) 222 WP_014480704.1 competence pheromone ComX -
  K6K00_RS16925 (BsBEST3145_32740) comQ 3229510..3230373 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  K6K00_RS16930 (BsBEST3145_32750) degQ 3230558..3230698 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  K6K00_RS16935 - 3230920..3231045 (+) 126 WP_003228793.1 hypothetical protein -
  K6K00_RS16940 (BsBEST3145_32760) - 3231159..3231527 (+) 369 WP_014477834.1 hypothetical protein -
  K6K00_RS16945 (BsBEST3145_32770) pdeH 3231503..3232732 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  K6K00_RS16950 (BsBEST3145_32780) pncB 3232868..3234340 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  K6K00_RS16955 (BsBEST3145_32790) pncA 3234356..3234907 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  K6K00_RS16960 (BsBEST3145_32800) yueI 3235004..3235402 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=74702 K6K00_RS16930 WP_003220708.1 3230558..3230698(-) (degQ) [Bacillus subtilis strain BEST3145]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=74702 K6K00_RS16930 WP_003220708.1 3230558..3230698(-) (degQ) [Bacillus subtilis strain BEST3145]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment