Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   K6K00_RS13080 Genome accession   NZ_AP024628
Coordinates   2524222..2524395 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain BEST3145     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2519222..2529395
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6K00_RS13065 (BsBEST3145_25330) gcvT 2520021..2521109 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  K6K00_RS13070 (BsBEST3145_25340) hepAA 2521551..2523224 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  K6K00_RS13075 (BsBEST3145_25350) yqhG 2523245..2524039 (+) 795 WP_003230200.1 YqhG family protein -
  K6K00_RS13080 (BsBEST3145_25360) sinI 2524222..2524395 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  K6K00_RS13085 (BsBEST3145_25370) sinR 2524429..2524764 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  K6K00_RS13090 (BsBEST3145_25380) tasA 2524857..2525642 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  K6K00_RS13095 (BsBEST3145_25390) sipW 2525706..2526278 (-) 573 WP_003246088.1 signal peptidase I SipW -
  K6K00_RS13100 (BsBEST3145_25400) tapA 2526262..2527023 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  K6K00_RS13105 (BsBEST3145_25410) yqzG 2527295..2527621 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  K6K00_RS13110 (BsBEST3145_25420) spoIITA 2527663..2527842 (-) 180 WP_003230176.1 YqzE family protein -
  K6K00_RS13115 (BsBEST3145_25430) comGG 2527913..2528287 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  K6K00_RS13120 (BsBEST3145_25440) comGF 2528288..2528671 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  K6K00_RS13125 (BsBEST3145_25450) comGE 2528697..2529044 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=74666 K6K00_RS13080 WP_003230187.1 2524222..2524395(+) (sinI) [Bacillus subtilis strain BEST3145]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=74666 K6K00_RS13080 WP_003230187.1 2524222..2524395(+) (sinI) [Bacillus subtilis strain BEST3145]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1