Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   QAP03_RS00935 Genome accession   NZ_CP122955
Coordinates   194127..194240 (+) Length   37 a.a.
NCBI ID   WP_001217870.1    Uniprot ID   -
Organism   Helicobacter pylori strain BS27-2     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 189127..199240
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAP03_RS00910 (QAP03_00910) - 189170..191395 (+) 2226 WP_286491160.1 ATP-dependent Clp protease ATP-binding subunit -
  QAP03_RS00915 (QAP03_00915) panD 191385..191738 (+) 354 WP_000142250.1 aspartate 1-decarboxylase -
  QAP03_RS00920 (QAP03_00920) - 191741..192043 (+) 303 WP_120956962.1 YbaB/EbfC family nucleoid-associated protein -
  QAP03_RS00925 (QAP03_00925) - 192043..193047 (+) 1005 WP_286491159.1 PDZ domain-containing protein -
  QAP03_RS00930 (QAP03_00930) comB6 193056..194111 (+) 1056 WP_286491158.1 P-type conjugative transfer protein TrbL Machinery gene
  QAP03_RS00935 (QAP03_00935) comB7 194127..194240 (+) 114 WP_001217870.1 hypothetical protein Machinery gene
  QAP03_RS00940 (QAP03_00940) comB8 194237..194980 (+) 744 WP_001208392.1 virB8 family protein Machinery gene
  QAP03_RS00945 (QAP03_00945) comB9 194980..195942 (+) 963 WP_286491157.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QAP03_RS00950 (QAP03_00950) comB10 195935..197071 (+) 1137 WP_180411350.1 DNA type IV secretion system protein ComB10 Machinery gene
  QAP03_RS00955 (QAP03_00955) - 197141..198553 (+) 1413 WP_286491156.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4305.26 Da        Isoelectric Point: 9.3572

>NTDB_id=744510 QAP03_RS00935 WP_001217870.1 194127..194240(+) (comB7) [Helicobacter pylori strain BS27-2]
MRIFFVIMGLLLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=744510 QAP03_RS00935 WP_001217870.1 194127..194240(+) (comB7) [Helicobacter pylori strain BS27-2]
ATGAGAATTTTTTTTGTTATCATGGGACTTTTGTTATTTGGTTGCACGAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

94.595

100

0.946