Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   QAD59_RS00735 Genome accession   NZ_CP122951
Coordinates   154910..155023 (+) Length   37 a.a.
NCBI ID   WP_073422943.1    Uniprot ID   -
Organism   Helicobacter pylori strain BS26     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 149910..160023
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAD59_RS00710 (QAD59_00710) - 149969..152194 (+) 2226 WP_286490160.1 ATP-dependent Clp protease ATP-binding subunit -
  QAD59_RS00715 (QAD59_00715) panD 152184..152534 (+) 351 WP_140596026.1 aspartate 1-decarboxylase -
  QAD59_RS00720 (QAD59_00720) - 152545..152838 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  QAD59_RS00725 (QAD59_00725) - 152838..153833 (+) 996 WP_140446199.1 PDZ domain-containing protein -
  QAD59_RS00730 (QAD59_00730) comB6 153839..154894 (+) 1056 WP_286490522.1 P-type conjugative transfer protein TrbL Machinery gene
  QAD59_RS00735 (QAD59_00735) comB7 154910..155023 (+) 114 WP_073422943.1 comB7 lipoprotein Machinery gene
  QAD59_RS00740 (QAD59_00740) comB8 155020..155763 (+) 744 WP_140578636.1 virB8 family protein Machinery gene
  QAD59_RS00745 (QAD59_00745) comB9 155763..156725 (+) 963 WP_286490163.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QAD59_RS00750 (QAD59_00750) comB10 156718..157854 (+) 1137 WP_286490164.1 DNA type IV secretion system protein ComB10 Machinery gene
  QAD59_RS00755 (QAD59_00755) - 157924..159336 (+) 1413 WP_286490165.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4287.23 Da        Isoelectric Point: 9.3572

>NTDB_id=744349 QAD59_RS00735 WP_073422943.1 154910..155023(+) (comB7) [Helicobacter pylori strain BS26]
MRIFFVIIGLILFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=744349 QAD59_RS00735 WP_073422943.1 154910..155023(+) (comB7) [Helicobacter pylori strain BS26]
ATGAGAATTTTTTTTGTTATTATTGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919