Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BsBEST3145_RS16950 Genome accession   NZ_AP024625
Coordinates   3223198..3223338 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BEST3109     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3218198..3228338
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BsBEST3145_RS16925 (BsBEST3109_32460) yuxO 3218511..3218891 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  BsBEST3145_RS16930 (BsBEST3109_32470) comA 3218910..3219554 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BsBEST3145_RS16935 comP 3219635..3221944 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  BsBEST3145_RS16940 (BsBEST3109_32500) comX 3221959..3222126 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  BsBEST3145_RS16945 (BsBEST3109_32510) comQ 3222114..3223013 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  BsBEST3145_RS16950 (BsBEST3109_32520) degQ 3223198..3223338 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BsBEST3145_RS16955 - 3223560..3223685 (+) 126 WP_003228793.1 hypothetical protein -
  BsBEST3145_RS16960 (BsBEST3109_32530) - 3223799..3224167 (+) 369 WP_003243784.1 hypothetical protein -
  BsBEST3145_RS16965 (BsBEST3109_32540) pdeH 3224143..3225372 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  BsBEST3145_RS16970 (BsBEST3109_32550) pncB 3225509..3226981 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  BsBEST3145_RS16975 (BsBEST3109_32560) pncA 3226997..3227548 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  BsBEST3145_RS16980 (BsBEST3109_32570) yueI 3227645..3228043 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=74238 BsBEST3145_RS16950 WP_003220708.1 3223198..3223338(-) (degQ) [Bacillus subtilis strain BEST3109]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=74238 BsBEST3145_RS16950 WP_003220708.1 3223198..3223338(-) (degQ) [Bacillus subtilis strain BEST3109]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment